To display the status of a virtual local area network (VLAN) mapping on a port, use the
showinterfacesvlanmapping command in user EXEC or privileged EXEC mode.
Interface type; possible valid values are
ethernet,
fastethernet,
gigabitethernet,
tengigabitethernet,
pos,
atm, and
ge-wan.
interface-number
Module and port number; see the “Usage Guidelines” section for valid values.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(17b)SXA
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
The
pos,
atm, and
ge-wan keywords are supported on Cisco 7600 series routers that are configured with a Supervisor Engine 2.
The
interface-number designates the module and port number. Valid values depend on the chassis and module that are used. For example, if you have a 48-port 10/100BASE-T Ethernet module that is installed in a 13-slot chassis, valid values for the slot number are from 1 to 13 and valid values for the port number are from 1 to 48.
Examples
This example shows how to list all of the VLAN mappings that are configured on a port and indicate whether such mappings are enabled or disabled on the port:
Router# show interfaces gigabitethernet 5/2 vlan mapping
State: enabled
Original VLAN Translated VLAN
------------- ---------------
1649 755
Router#
Related Commands
Command
Description
showvlanmapping
Registers a mapping of an 802.1Q VLAN to an ISL VLAN.
switchportvlanmappingenable
Enables VLAN mapping per switch port.
show interfaces wlan-controller
To show the Cisco Wireless Local Area Network (WLAN) controller network module interfaces on the router, use the showinterfaceswlan-controller command in privileged EXEC mode.
showinterfaceswlan-controllerslot /unit
Syntax Description
slot/unit
Specifies the router slot and unit numbers for the WLAN controller network module.
Command Default
None
Command Modes
Privileged EXEC
Command History
Release
Modification
12.4(2)XA1
This command was introduced on the router software.
12.4(6)T
This command was integrated into Cisco IOS Release 12.4(6)T.
Examples
The following example shows how to read the hardware information about the interface WLAN controller in the router:
Router# show interfaces wlan-controller 1/0
wlan-controller1/0 is up, line protocol is up
Hardware is I82559FE, address is 0005.9a3d.7450 (bia 0005.9a3d.7450)
Internet address is 30.0.0.1/24
MTU 1500 bytes, BW 100000 Kbit, DLY 100 usec,
reliability 255/255, txload 1/255, rxload 1/255
Encapsulation 802.1Q Virtual LAN, Vlan ID 1., loopback not set
Keepalive set (10 sec)
Full-duplex, 100Mb/s, 100BaseTX/FX
ARP type: ARPA, ARP Timeout 04:00:00
Last input 00:00:05, output 00:00:03, output hang never
Last clearing of "show interface" counters never
Input queue: 0/75/0/0 (size/max/drops/flushes); Total output drops: 0
Queueing strategy: fifo
Output queue: 0/40 (size/max)
5 minute input rate 0 bits/sec, 0 packets/sec
5 minute output rate 0 bits/sec, 0 packets/sec
2400779 packets input, 143127299 bytes
Received 2349587 broadcasts, 0 runts, 0 giants, 0 throttles
0 input errors, 0 CRC, 0 frame, 0 overrun, 0 ignored
0 watchdog
0 input packets with dribble condition detected
468232 packets output, 106333102 bytes, 0 underruns
0 output errors, 0 collisions, 3 interface resets
0 babbles, 0 late collision, 0 deferred
0 lost carrier, 1 no carrier
0 output buffer failures, 0 output buffers swapped out
show ip interface
To display the usability status of interfaces configured for IP, use the
showipinterface command in privileged EXEC mode.
showipinterface
[ typenumber ]
[brief]
Syntax Description
type
(Optional) Interface type.
number
(Optional) Interface number.
brief
(Optional) Displays a summary of the usability status information for each interface.
Command Default
The full usability status is displayed for all interfaces configured for IP.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
10.0
This command was introduced.
12.0(3)T
The command output was modified to show the status of the
ipwccpredirectout and
ipwccpredirectexcludeaddin commands.
12.2(14)S
The command output was modified to display the status of NetFlow on a subinterface.
12.2(15)T
The command output was modified to display the status of NetFlow on a subinterface.
12.3(6)
The command output was modified to identify the downstream VPN routing and forwarding (VRF) instance in the output.
12.3(14)YM2
The command output was modified to show the usability status of interfaces configured for Multiprocessor Forwarding (MPF) and implemented on the Cisco 7301 and Cisco 7206VXR routers.
12.2(14)SX
This command was implemented on the Supervisor Engine 720.
12.2(17d)SXB
This command was integrated into Cisco IOS 12.2(17d)SXB on the Supervisor Engine 2, and the command output was changed to include NDE for hardware flow status.
12.4(4)T
This command was integrated into Cisco IOS Release 12.4(4)T.
12.2(28)SB
This command was integrated into Cisco IOS Release 12.2(28)SB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(31)SB2
The command output was modified to display information about the Unicast Reverse Path Forwarding (RPF) notification feature.
12.4(20)T
The command output was modified to display information about the Unicast RPF notification feature.
12.2(33)SXI2
This command was modified. The command output was modified to display information about the Unicast RPF notification feature.
Cisco IOS XE Release 2.5
This command was modified. This command was implemented on the Cisco ASR 1000 Series Aggregation Services Routers.
Cisco IOS XE Release 3.9S
This command was implemented on Cisco 4400 Series ISRs.
Usage Guidelines
The Cisco IOS software automatically enters a directly connected route in the routing table if the interface is usable (which means that it can send and receive packets). If an interface is not usable, the directly connected routing entry is removed from the routing table. Removing the entry lets the software use dynamic routing protocols to determine backup routes to the network, if any.
If the interface can provide two-way communication, the line protocol is marked "up." If the interface hardware is usable, the interface is marked "up."
If you specify an optional interface type, information for that specific interface is displayed. If you specify no optional arguments, information on all the interfaces is displayed.
When an asynchronous interface is encapsulated with PPP or Serial Line Internet Protocol (SLIP), IP fast switching is enabled. A
showipinterface command on an asynchronous interface encapsulated with PPP or SLIP displays a message indicating that IP fast switching is enabled.
You can use the
showipinterfacebrief command to display a summary of the router interfaces. This command displays the IP address, the interface status, and other information.
The
showipinterfacebrief command does not display any information related to Unicast RPF.
Examples
The following example shows configuration information for interface Gigabit Ethernet 0/3. In this example, the IP flow egress feature is configured on the output side (where packets go out of the interface), and the policy route map named PBRNAME is configured on the input side (where packets come into the interface).
Router# show running-config interface gigabitethernet 0/3
interface GigabitEthernet0/3
ip address 10.1.1.1 255.255.0.0
ip flow egress
ip policy route-map PBRNAME
duplex auto
speed auto
media-type gbic
negotiation auto
end
The following example shows interface information on Gigabit Ethernet interface 0/3. In this example, MPF is enabled, and both Policy Based Routing (PBR) and NetFlow features are not supported by MPF and are ignored.
Router# show ip interface gigabitethernet 0/3
GigabitEthernet0/3 is up, line protocol is up
Internet address is 10.1.1.1/16
Broadcast address is 255.255.255.255
Address determined by setup command
MTU is 1500 bytes
Helper address is not set
Directed broadcast forwarding is disabled
Outgoing access list is not set
Inbound access list is not set
Proxy ARP is enabled
Local Proxy ARP is disabled
Security level is default
Split horizon is enabled
ICMP redirects are always sent
ICMP unreachables are always sent
ICMP mask replies are never sent
IP fast switching is enabled
IP fast switching on the same interface is disabled
IP Flow switching is disabled
IP CEF switching is enabled
IP Feature Fast switching turbo vector
IP VPN Flow CEF switching turbo vector
IP multicast fast switching is enabled
IP multicast distributed fast switching is disabled
IP route-cache flags are Fast, CEF
Router Discovery is disabled
IP output packet accounting is disabled
IP access violation accounting is disabled
TCP/IP header compression is disabled
RTP/IP header compression is disabled
Policy routing is enabled, using route map PBR
Network address translation is disabled
BGP Policy Mapping is disabled
IP Multi-Processor Forwarding is enabled
IP Input features, "PBR",
are not supported by MPF and are IGNORED
IP Output features, "NetFlow",
are not supported by MPF and are IGNORED
The following example identifies a downstream VRF instance. In the example, "Downstream VPN Routing/Forwarding "D"" identifies the downstream VRF instance.
Router# show ip interface virtual-access 3
Virtual-Access3 is up, line protocol is up
Interface is unnumbered. Using address of Loopback2 (10.0.0.8)
Broadcast address is 255.255.255.255
Peer address is 10.8.1.1
MTU is 1492 bytes
Helper address is not set
Directed broadcast forwarding is disabled
Outgoing access list is not set
Inbound access list is not set
Proxy ARP is enabled
Local Proxy ARP is disabled
Security level is default
Split horizon is enabled
ICMP redirects are always sent
ICMP unreachables are always sent
ICMP mask replies are never sent
IP fast switching is enabled
IP fast switching on the same interface is enabled
IP Flow switching is disabled
IP CEF switching is enabled
IP Feature Fast switching turbo vector
IP VPN CEF switching turbo vector
VPN Routing/Forwarding "U"
Downstream VPN Routing/Forwarding "D"
IP multicast fast switching is disabled
IP multicast distributed fast switching is disabled
IP route-cache flags are Fast, CEF
Router Discovery is disabled
IP output packet accounting is disabled
IP access violation accounting is disabled
TCP/IP header compression is disabled
RTP/IP header compression is disabled
Policy routing is disabled
Network address translation is disabled
WCCP Redirect outbound is disabled
WCCP Redirect inbound is disabled
WCCP Redirect exclude is disabled
BGP Policy Mapping is disabled
The following example shows the information displayed when Unicast RPF drop-rate notification is configured:
Router# show ip interface ethernet 2/3
Ethernet2/3 is up, line protocol is up
Internet address is 10.0.0.4/16
Broadcast address is 255.255.255.255
Address determined by non-volatile memory
MTU is 1500 bytes
Helper address is not set
Directed broadcast forwarding is disabled
Outgoing access list is not set
Inbound access list is not set
Proxy ARP is enabled
Local Proxy ARP is disabled
Security level is default
Split horizon is enabled
ICMP redirects are always sent
ICMP unreachables are always sent
ICMP mask replies are never sent
IP fast switching is disabled
IP Flow switching is disabled
IP CEF switching is disabled
IP Null turbo vector
IP Null turbo vector
IP multicast fast switching is disabled
IP multicast distributed fast switching is disabled
IP route-cache flags are No CEF
Router Discovery is disabled
IP output packet accounting is disabled
IP access violation accounting is disabled
TCP/IP header compression is disabled
RTP/IP header compression is disabled
Probe proxy name replies are disabled
Policy routing is disabled
Network address translation is disabled
WCCP Redirect outbound is disabled
WCCP Redirect inbound is disabled
WCCP Redirect exclude is disabled
BGP Policy Mapping is disabled
The following example shows how to display the usability status for a specific VLAN:
Router# show ip interface vlan 1
Vlan1 is up, line protocol is up
Internet address is 10.0.0.4/24
Broadcast address is 255.255.255.255
Address determined by non-volatile memory
MTU is 1500 bytes
Helper address is not set
Directed broadcast forwarding is disabled
Outgoing access list is not set
Inbound access list is not set
Proxy ARP is enabled
Local Proxy ARP is disabled
Security level is default
Split horizon is enabled
ICMP redirects are always sent
ICMP unreachables are always sent
ICMP mask replies are never sent
IP fast switching is enabled
IP fast switching on the same interface is disabled
IP Flow switching is disabled
IP CEF switching is enabled
IP Fast switching turbo vector
IP Normal CEF switching turbo vector
IP multicast fast switching is enabled
IP multicast distributed fast switching is disabled
IP route-cache flags are Fast, CEF
Router Discovery is disabled
IP output packet accounting is disabled
IP access violation accounting is disabled
TCP/IP header compression is disabled
RTP/IP header compression is disabled
Probe proxy name replies are disabled
Policy routing is disabled
Network address translation is disabled
WCCP Redirect outbound is disabled
WCCP Redirect inbound is disabled
WCCP Redirect exclude is disabled
BGP Policy Mapping is disabled
Sampled Netflow is disabled
IP multicast multilayer switching is disabled
Netflow Data Export (hardware) is enabled
The table below describes the significant fields shown in the display.
Table 1 show ip interface Field Descriptions
Field
Description
Virtual-Access3 is up
Shows whether the interface hardware is usable (up). For an interface to be usable, both the interface hardware and line protocol must be up.
Broadcast address is
Broadcast address.
Peer address is
Peer address.
MTU is
MTU value set on the interface, in bytes.
Helper address
Helper address, if one is set.
Directed broadcast forwarding
Shows whether directed broadcast forwarding is enabled.
Outgoing access list
Shows whether the interface has an outgoing access list set.
Inbound access list
Shows whether the interface has an incoming access list set.
Proxy ARP
Shows whether Proxy Address Resolution Protocol (ARP) is enabled for the interface.
Security level
IP Security Option (IPSO) security level set for this interface.
Split horizon
Shows whether split horizon is enabled.
ICMP redirects
Shows whether redirect messages will be sent on this interface.
ICMP unreachables
Shows whether unreachable messages will be sent on this interface.
ICMP mask replies
Shows whether mask replies will be sent on this interface.
IP fast switching
Shows whether fast switching is enabled for this interface. It is generally enabled on serial interfaces, such as this one.
IP Flow switching
Shows whether Flow switching is enabled for this interface.
IP CEF switching
Shows whether Cisco Express Forwarding switching is enabled for the interface.
Downstream VPN Routing/Forwarding "D"
Shows the VRF instance where the PPP peer routes and AAA per-user routes are being installed.
IP multicast fast switching
Shows whether multicast fast switching is enabled for the interface.
IP route-cache flags are Fast
Shows whether NetFlow is enabled on an interface. Displays "Flow init" to specify that NetFlow is enabled on the interface. Displays "Ingress Flow" to specify that NetFlow is enabled on a subinterface using the
ipflowingresscommand. Shows "Flow" to specify that NetFlow is enabled on a main interface using the
iproute-cacheflow command.
Router Discovery
Shows whether the discovery process is enabled for this interface. It is generally disabled on serial interfaces.
IP output packet accounting
Shows whether IP accounting is enabled for this interface and what the threshold (maximum number of entries) is.
TCP/IP header compression
Shows whether compression is enabled.
WCCP Redirect outbound is disabled
Shows the status of whether packets received on an interface are redirected to a cache engine. Displays "enabled" or "disabled."
WCCP Redirect exclude is disabled
Shows the status of whether packets targeted for an interface will be excluded from being redirected to a cache engine. Displays "enabled" or "disabled."
Netflow Data Export (hardware) is enabled
NetFlow Data Expert (NDE) hardware flow status on the interface.
The table below describes the significant fields shown in the display.
Examples
In the following example, command show ip interface brief shows a summary of the interfaces and their status on the device.
Router#show ip interface brief
Interface IP-Address OK? Method Status Protocol
GigabitEthernet0/0/0 unassigned YES NVRAM down down
GigabitEthernet0/0/1 unassigned YES NVRAM down down
GigabitEthernet0/0/2 unassigned YES NVRAM down down
GigabitEthernet0/0/3 unassigned YES NVRAM down down
Serial1/0/0 unassigned YES unset down down
GigabitEthernet0 unassigned YES NVRAM up up
Examples
The following example shows how to display a summary of the usability status information for each interface:
Router# show ip interface brief
Interface IP-Address OK? Method Status Protocol
Ethernet0 10.108.00.5 YES NVRAM up up
Ethernet1 unassigned YES unset administratively down down
Loopback0 10.108.200.5 YES NVRAM up up
Serial0 10.108.100.5 YES NVRAM up up
Serial1 10.108.40.5 YES NVRAM up up
Serial2 10.108.100.5 YES manual up up
Serial3 unassigned YES unset administratively down down
Table 2 show ip interface brief Field Descriptions
Field
Description
Interface
Type of interface.
IP-Address
IP address assigned to the interface.
OK?
"Yes" means that the IP Address is valid. "No" means that the IP Address is not valid.
Method
The Method field has the following possible values:
RARP or SLARP--Reverse Address Resolution Protocol (RARP) or Serial Line Address Resolution Protocol (SLARP) request.
BOOTP--Bootstrap protocol.
TFTP--Configuration file obtained from the TFTP server.
manual--Manually changed by the command-line interface.
NVRAM--Configuration file in NVRAM.
IPCP--ipaddressnegotiated command.
DHCP--ipaddressdhcp command.
unset--Unset.
other--Unknown.
Status
Shows the status of the interface. Valid values and their meanings are:
up--Interface is up.
down--Interface is down.
administratively down--Interface is administratively down.
Protocol
Shows the operational status of the routing protocol on this interface.
Related Commands
Command
Description
ipaddress
Sets a primary or secondary IP address for an interface.
ipvrfautoclassify
Enables VRF autoclassify on a source interface.
matchipsource
Specifies a source IP address to match to required route maps that have been set up based on VRF connected routes.
route-map
Defines the conditions for redistributing routes from one routing protocol into another or to enable policy routing.
setvrf
Enables VPN VRF selection within a route map for policy-based routing VRF selection.
showiparp
Displays the ARP cache, in which SLIP addresses appear as permanent ARP table entries.
showroute-map
Displays static and dynamic route maps.
show ipc
To display interprocess communication (IPC) statistics, use the
showipc command in privileged EXEC mode.
showipc
{ nodes | ports [open] | queue | status [cumulative] | zones }
Syntax Description
nodes
Displays participating nodes.
ports
Displays local and registered IPC ports.
open
(Optional) Displays local IPC ports that have been opened by the current seat (node).
queue
Displays information about the IPC retransmission queue and the IPC message queue.
status
Displays the status of the local IPC server.
cumulative
(Optional) Displays cumulative totals for the status counters of the local IPC server since the router was rebooted.
zones
Displays information about the IPC zones and seats.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.1(12c)EW
This command was introduced.
12.2(15)T
The
cumulative keyword was added.
12.3(7)T
The
zones keyword was added.
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to 12.2(17d)SXB.
12.2(28)SB
This command was integrated into Cisco IOS Release 12.2(28)SB.
Usage Guidelines
The Cisco IOS version of IPC provides a reliable ordered delivery of messages using an underlying platform driver transport or User Datagram Protocol (UDP) transport protocol.
Nodes
A node (referred to as a seat) is an intelligent element like a processor that can communicate using IPC services. A seat is where entities and ports reside. A seat manager performs all the interprocessor communications by receiving messages from the network and forwarding the messages to the appropriate port.
Ports
IPC communication endpoints (ports) receive and queue received IPC messages.
Queue
Use the
queue keyword to display information about the IPC retransmission queue and the IPC message queue.
Status
Use thestatus keyword to display the IPC statistics that have been generated since a
clearipcstatistics command was entered. The
showipcstatus command with the
cumulative keyword displays the IPC statistics that have been gathered since the router was rebooted, regardless of how many times the statistics have been cleared.
Zones
The IPC zone manager allows more than one group of IPC seats to exist to enable direct communication between line cards and the route processor. Use thezones keyword to display the IPC zone and seat information.
Examples
The following is sample output from the
showipccommand with the
nodeskeyword displaying the participating seats (nodes):
Router# show ipc nodes
There are 6 nodes in this IPC realm.
ID Type Name Last Last
Sent Heard
0.10000 Local IPC Master 0 0
0.1060000 RSP-CY RSP IPC card slot 6 9 79
0.1050000 RSP-CY RSP IPC card slot 5 21 22
0.1080000 RSP-CY RSP IPC card slot 8 21 22
1.10000 Local IPC Master: -Zone#1 0 0
2.10000 Local IPC Master: -Zone#2
The table below describes the significant fields shown in the display.
Table 3 show ipc nodes Field Descriptions
Field
Description
ID
Port ID, which consists of a zone ID followed by the seat ID.
Type
Type of seat (node).
Name
Seat name.
Last Sent
Sequence number of the message that was last sent.
Last Heard
Sequence number of the in-sequence message that was last heard.
The following is sample output from the
showipccommand with the
portskeyword displaying the local and registered IPC ports:
Router# show ipc ports
There are 11 ports defined.
Port ID Type Name (current/peak/total)
1.10000.1 unicast IPC Master:Zone
1.10000.2 unicast IPC Master:Echo
1.10000.3 unicast IPC Master:Control
1.10000.4 unicast Remote TTY Server Port
1.10000.5 unicast GALIOS RF :Active
index = 0 seat_id = 0x2020000 last sent = 0 heard = 1635 0/1/1635
1.10000.6 unicast GALIOS RED:Active
index = 0 seat_id = 0x2020000 last sent = 0 heard = 2 0/1/2
2.2020000.3 unicast GALIOS IPC:Card 2:Control
2.2020000.4 unicast GALIOS RFS :Standby
2.2020000.5 unicast Slave: Remote TTY Client Port
2.2020000.6 unicast GALIOS RF :Standby
2.2020000.7 unicast GALIOS RED:Standby
RPC packets: current/peak/total 0/1/17
The table below describes the significant fields shown in the display.
Table 4 show ipc ports Field Descriptions
Field
Description
Port ID
Port ID, which consists of a zone ID followed by the seat ID.
Type
Type of port.
Name
Port name.
current/peak/total
Displays information about the number of messages held by this IPC session.
The following is sample output from the
showipccommand with the
queuekeyword displaying information about the IPC retransmission queue and the IPC message queue:
Router# show ipc queue
There are 0 IPC messages waiting for acknowledgement in the transmit queue.
There are 0 IPC messages waiting for a response.
There are 0 IPC messages waiting for additional fragments.
There are 0 IPC messages currently on the IPC inboundQ.
There are 0 messages currently in use by the system.
The following is sample output from the
showipccommand with the
statuskeyword displaying information about the local IPC server:
Router# show ipc status
IPC System Status
Time last IPC stat cleared : never
This processor is the IPC master server.
Do not drop output of IPC frames for test purposes.
1000 IPC Message Headers Cached.
Rx Side Tx Side
Total Frames 189 140
Total from Local Ports 189 70
Total Protocol Control Frames 70 44
Total Frames Dropped 0 0
Service Usage
Total via Unreliable Connection-Less Service 145 0
Total via Unreliable Sequenced Connection-Less Svc 0 0
Total via Reliable Connection-Oriented Service 44 70
IPC Protocol Version 0
Total Acknowledgements 70 44
Total Negative Acknowledgements 0 0
Device Drivers
Total via Local Driver 0 0
Total via Platform Driver 0 70
Total Frames Dropped by Platform Drivers 0 0
Reliable Tx Statistics
Re-Transmission 0
Re-Tx Timeout 0
Rx Errors Tx Errors
Unsupp IPC Proto Version 0 Tx Session Error 0
Corrupt Frame 0 Tx Seat Error 0
Duplicate Frame 0 Destination Unreachable 0
Out-of-Sequence Frame 0 Tx Test Drop 0
Dest Port does Not Exist 0 Tx Driver Failed 0
Rx IPC Msg Alloc Failed 0 Ctrl Frm Alloc Failed 0
Unable to Deliver Msg 0
Buffer Errors Misc Errors
IPC Msg Alloc 0 IPC Open Port 0
Emer IPC Msg Alloc 0 No HWQ 0
IPC Frame PakType Alloc 0 Hardware Error 0
IPC Frame MemD Alloc 0
Tx Driver Errors
No Transport 0
MTU Failure 0
Dest does not Exist 0
The table below describes the significant fields shown in the display.
Table 5 show ipc status Field Descriptions
Field
Description
Time last IPC stat cleared
Displays the time, in dd:hh:mm (or never), since the IPC statistics were last cleared.
This processor is
Shows whether the processor is the IPC master or an IPC slave.
IPC Message Headers Cached
Number of message headers available in the IPC message cache.
Rx Side
Information about IPC messages received.
Tx Side
Information about IPC messages sent.
Service Usage
Number of IPC messages received or sent via connectionless or connection-oriented protocols.
IPC Protocol Version 0
Number of acknowledgements and negative acknowledgements received or sent by the system.
Device Drivers
Number of IPC messages received or sent using the underlying device drivers.
Reliable Tx Statistics
Number of IPC messages that were retransmitted or that timed out on retransmission using a reliable connection-oriented protocol.
Rx Errors
Number of IPC messages received that displayed various internal frame or delivery errors.
Tx Errors
Number of IPC messages sent that displayed various transmission errors.
Buffer Errors
Number of message allocation failures from the IPC message cache, IPC emergency message cache, IPC frame allocation cache, and IPC frame memory allocation cache.
Misc Errors
Various miscellaneous errors that relate to the IPC open queue, to the hardware queue, or to other hardware failures.
Tx Driver Errors
Number of messages that relate to IPC transmission driver failures including messages to or from a destination without a valid transport entity from the seat; number of messages dropped because the packet size is larger than the maximum transmission unit (MTU); and number of messages without a valid destination address.
The following example shows how to display cumulative IPC counters for the local IPC server. Note that the recent IPC clearing has not cleared the IPC counters because the
cumulative keyword displays the IPC statistics that have been generated since the router was rebooted.
Router# show ipc status cumulative
IPC System Status
Time last IPC stat cleared : 00:00:05
This processor is the IPC master server.
Do not drop output of IPC frames for test purposes.
1000 IPC Message Headers Cached.
Rx Side Tx Side
Total Frames 3473 184
Total from Local Ports 3473 92
Total Protocol Control Frames 92 54
Total Frames Dropped 0 0
Service Usage
Total via Unreliable Connection-Less Service 2449 0
Total via Unreliable Sequenced Connection-Less Svc 970 0
Total via Reliable Connection-Oriented Service 54 92
IPC Protocol Version 0
Total Acknowledgements 0 0
Total Negative Acknowledgements 0 0
Device Drivers
Total via Local Driver 0 0
Total via Platform Driver 0 92
Total Frames Dropped by Platform Drivers 0 0
Reliable Tx Statistics
Re-Transmission 0
Re-Tx Timeout 0
Rx Errors Tx Errors
Unsupp IPC Proto Version 0 Tx Session Error 0
Corrupt Frame 0 Tx Seat Error 0
Duplicate Frame 0 Destination Unreachable 0
Out-of-Sequence Frame 0 Tx Test Drop 0
Dest Port does Not Exist 0 Tx Driver Failed 0
Rx IPC Msg Alloc Failed 0 Ctrl Frm Alloc Failed 0
Unable to Deliver Msg 0
Buffer Errors Misc Errors
IPC Msg Alloc 0 IPC Open Port 0
Emer IPC Msg Alloc 0 No HWQ 0
IPC Frame PakType Alloc 0 Hardware Error 0
IPC Frame MemD Alloc 0
Tx Driver Errors
No Transport 0
MTU Failure 0
Dest does not Exist 0
The following is sample output from the
showipccommand with the
zoneskeyword displaying information about the IPC zones and seats:
Router# show ipc zones
There are 3 Zones in this IPC realm.
Zone ID Seat ID Name
0 10000 IPC Default Zone
1 10000 IPC TEST ZONE#1
2 10000 IPC TEST ZONE#2
The table below describes the significant fields shown in the display.
Table 6 show ipc zones Field Descriptions
Field
Description
Zone ID
Zone number.
Seat ID
Seat number.
Name
Zone name.
Related Commands
Command
Description
clearipcstatistics
Clears and resets the IPC statistics.
show ipc hog-info
To provide information about interprocess communication (IPC) messages that consume excessive CPU, use the showipchog-infocommand in privileged EXEC mode.
showipchog-info
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.2(15)T
This command was introduced.
12.2(28)SB
This command was integrated into Cisco IOS Release 12.2(28)SB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
The Cisco IOS version of IPC provides a reliable ordered delivery of messages using an underlying platform driver transport or User Datagram Protocol (UDP) transport protocol.
The show ipc hog-info command displays information about IPC messages that are being processed when a CPUHOG error occurs, indicating that the client processing an IPC message is using too much CPU, or when an IPC message callback exceeds 200 milliseconds.
Examples
The following example shows that the IPC process has had a CPUHOG error or the message callback exceeded the 200-millisecond threshold:
Router# show ipc hog-info
Time last IPC process hogged CPU: 00:05:09
IPC Messages Processed:
Source Destination Name Message-Type Time-taken
(0x) (msec)
1030000 10000.14 ISSU Process: Active Por 0 864
1030000 10000.D RF : Active 0 0
In the following example, the show ipc status command shows a counter incrementing whenever a callback exceeds 200 milliseconds:
Router# show ipc status
IPC System Status
Time last IPC stat cleared : never
This processor is the IPC master server.
Do not drop output of IPC frames for test purposes.
1000 IPC Message Headers Cached.
Rx Side Tx Side
Total Frames 9501 3973
Total from Local Ports 14328 3258
Total Protocol Control Frames 1628 713
Total Frames Dropped 0 0
Service Usage
Total via Unreliable Connection-Less Service 7865 0
Total via Unreliable Sequenced Connection-Less Svc 0 0
Total via Reliable Connection-Oriented Service 831 1629
IPC Protocol Version 0
Total Acknowledgments 1628 713
Total Negative Acknowledgments 0 0
Device Drivers
Total via Local Driver 12 12
Total via Platform Driver 9478 1619
Total Frames Dropped by Platform Drivers 0 0
Total Frames Sent when media is quiesced 0
Reliable Tx Statistics
Re-Transmission 0
Re-Tx Timeout 0
Rx Errors Tx Errors
Unsupp IPC Proto Version 0 Tx Session Error 0
Corrupt Frame 0 Tx Seat Error 0
Duplicate Frame 0 Destination Unreachable 0
Rel Out-of-Seq Frame 0 Unrel Out-of-Seq Frame 0
Dest Port does Not Exist 0 Tx Driver Failed 0
Rx IPC Msg Alloc Failed 0 Rx IPC Frag Dropped 0
Rx IPC Transform Errors 0 Tx IPC Transform Errors 0
Unable to Deliver Msg 0 Tx Test Drop 0
Ctrl Frm Alloc Failed 0 Rx Msg Callback Hog 11
Buffer Errors Misc Errors
IPC Msg Alloc 0 IPC Open Port 0
Emer IPC Msg Alloc 0 No HWQ 0
IPC Frame PakType Alloc 0 Hardware Error 0
IPC Frame MemD Alloc 0 Invalid Messages 0
Tx Driver Errors
No Transport 0
MTU Failure 0
Dest does not Exist 0
Related Commands
Command
Description
showipc
Displays IPC statistics.
show ipv6 ospf interface
To display Open Shortest Path First (OSPF)-related interface information, use the
showipv6ospfinterface command in user EXEC or privileged mode.
(Optional) Internal identification. It is locally assigned and can be any positive integer. The number used here is the number assigned administratively when the OSPF routing process is enabled.
area-id
(Optional) Displays information about a specified area only.
typenumber
(Optional) Interface type and number.
brief
(Optional) Displays brief overview information for OSPF interfaces, states, addresses and masks, and areas on the router.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.0(24)S
This command was introduced.
12.2(15)T
This command was integrated into Cisco IOS Release 12.2(15)T.
12.2(18)S
This command was integrated into Cisco IOS Release 12.2(18)S.
12.3(4)T
Command output is changed when authentication is enabled.
12.2(28)SB
This command was integrated into Cisco IOS Release 12.2(28)SB.
12.2(25)SG
This command was integrated into Cisco IOS Release 12.2(25)SG.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.4(9)T
Command output is changed when encryption is enabled.
12.2(33)SRB
The
brief keyword was added.
12.4(15)XF
Output displays were modified so that VMI PPPoE interface-based local state values are displayed in the command output when a VMI interface is specified.
12.4(15)T
This command was integrated into Cisco IOS Release 12.4(15)T
12.2(33)SXH
This command was integrated into Cisco IOS Release 12.2(33)SXH.
Cisco IOS XE Release 2.1
Command output was updated to display graceful restart information.
12.2(33)SRE
This command was modified. It was integrated into Cisco IOS Release 12.2(33)SRE.
15.1(1)SY
This command was was modified. It was integrated into Cisco IOS Release 15.1(1)SY.
Examples
Examples
The following is sample output from the
showipv6ospfinterface command:
Router# show ipv6 ospf interface
ATM3/0 is up, line protocol is up
Link Local Address 2001:0DB1:205:5FFF:FED3:5808, Interface ID 13
Area 1, Process ID 1, Instance ID 0, Router ID 172.16.3.3
Network Type POINT_TO_POINT, Cost: 1
Transmit Delay is 1 sec, State POINT_TO_POINT,
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:06
Index 1/2/2, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 12, maximum is 12
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 172.16.4.4
Suppress hello for 0 neighbor(s)
FastEthernet0/0 is up, line protocol is up
Link Local Address 2001:0DB1:205:5FFF:FED3:5808, Interface ID 3
Area 1, Process ID 1, Instance ID 0, Router ID 172.16.3.3
Network Type BROADCAST, Cost: 1
Transmit Delay is 1 sec, State BDR, Priority 1
Designated Router (ID) 172.16.6.6, local address 2001:0DB1:205:5FFF:FED3:6408
Backup Designated router (ID) 172.16.3.3, local address 2001:0DB1:205:5FFF:FED3:5808
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:05
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 12, maximum is 12
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 172.16.6.6 (Designated Router)
Suppress hello for 0 neighbor(s)
The table below describes the significant fields shown in the display.
Table 7 show ipv6 ospf interface Field Descriptions
Field
Description
ATM3/0
Status of the physical link and operational status of protocol.
Link Local Address
Interface IPv6 address.
Area 1, Process ID 1, Instance ID 0, Router ID 172.16.3.3
The area ID, process ID, instance ID, and router ID of the area from which this route is learned.
Network Type POINT_TO_POINT, Cost: 1
Network type and link-state cost.
Transmit Delay
Transmit delay, interface state, and router priority.
Designated Router
Designated router ID and respective interface IP address.
Backup Designated router
Backup designated router ID and respective interface IP address.
Timer intervals configured
Configuration of timer intervals.
Hello
Number of seconds until the next hello packet is sent out this interface.
Neighbor Count
Count of network neighbors and list of adjacent neighbors.
Examples
The following is sample output of the
showipv6ospfinterface command when the
brief keyword is entered.
Router# show ipv6 ospf interface brief
Interface PID Area Intf ID Cost State Nbrs F/C
VL0 6 0 21 65535 DOWN 0/0
Se3/0 6 0 14 64 P2P 0/0
Lo1 6 0 20 1 LOOP 0/0
Se2/0 6 6 10 62 P2P 0/0
Tu0 1000 0 19 11111 DOWN 0/0
Examples
The following is sample output from the
showipv6ospfinterface command with authentication enabled on the interface:
Router# show ipv6 ospf interface
Ethernet0/0 is up, line protocol is up
Link Local Address 2001:0DB1:A8BB:CCFF:FE00:6E00, Interface ID 2
Area 0, Process ID 1, Instance ID 0, Router ID 10.10.10.1
Network Type BROADCAST, Cost:10
MD5 Authentication SPI 500, secure socket state UP (errors:0)
Transmit Delay is 1 sec, State BDR, Priority 1
Designated Router (ID) 10.11.11.1, local address 2001:0DB1:A8BB:CCFF:FE00:6F00
Backup Designated router (ID) 10.10.10.1, local address
2001:0DB1:A8BB:CCFF:FE00:6E00
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:01
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 1, maximum is 1
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 10.11.11.1 (Designated Router)
Suppress hello for 0 neighbor(s)
Examples
The following is sample output from the
showipv6ospfinterface command with null authentication configured on the interface:
Router# show ipv6 ospf interface
Ethernet0/0 is up, line protocol is up
Link Local Address 2001:0DB1:A8BB:CCFF:FE00:6E00, Interface ID 2
Area 0, Process ID 1, Instance ID 0, Router ID 10.10.10.1
Network Type BROADCAST, Cost:10
Authentication NULL
Transmit Delay is 1 sec, State BDR, Priority 1
Designated Router (ID) 10.11.11.1, local address 2001:0DB1:A8BB:CCFF:FE00:6F00
Backup Designated router (ID) 10.10.10.1, local address
2001:0DB1:A8BB:CCFF:FE00:6E00
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:03
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 1, maximum is 1
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 10.11.11.1 (Designated Router)
Suppress hello for 0 neighbor(s)
Examples
The following is sample output from the
showipv6ospfinterface command with authentication configured for the area:
Router# show ipv6 ospf interface
Ethernet0/0 is up, line protocol is up
Link Local Address 2001:0DB1:A8BB:CCFF:FE00:6E00, Interface ID 2
Area 0, Process ID 1, Instance ID 0, Router ID 10.10.10.1
Network Type BROADCAST, Cost:10
MD5 Authentication (Area) SPI 1000, secure socket state UP (errors:0)
Transmit Delay is 1 sec, State BDR, Priority 1
Designated Router (ID) 10.11.11.1, local address 2001:0DB1:A8BB:CCFF:FE00:6F00
Backup Designated router (ID) 10.10.10.1, local address
FE80::A8BB:CCFF:FE00:6E00
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:03
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 1, maximum is 1
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 10.11.11.1 (Designated Router)
Suppress hello for 0 neighbor(s)
Examples
The following display shows sample output from the
showipv6ospfinterface command when the OSPF cost dynamic is configured.
Router1# show ipv6 ospf interface serial 2/0
Serial2/0 is up, line protocol is up
Link Local Address 2001:0DB1:A8BB:CCFF:FE00:100, Interface ID 10
Area 1, Process ID 1, Instance ID 0, Router ID 172.1.1.1
Network Type POINT_TO_MULTIPOINT, Cost: 64 (dynamic), Cost Hysteresis: 200
Cost Weights: Throughput 100, Resources 20, Latency 80, L2-factor 100
Transmit Delay is 1 sec, State POINT_TO_MULTIPOINT,
Timer intervals configured, Hello 30, Dead 120, Wait 120, Retransmit 5
Hello due in 00:00:19
Index 1/2/3, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 0, maximum is 0
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 0, Adjacent neighbor count is 0
Suppress hello for 0 neighbor(s)
Examples
The following display shows sample output from the
showipv6ospfinterface command when the OSPF graceful restart feature is configured:
Router# show ipv6 ospf interface
Ethernet0/0 is up, line protocol is up
Link Local Address FE80::A8BB:CCFF:FE00:300, Interface ID 2
Area 0, Process ID 1, Instance ID 0, Router ID 10.3.3.3
Network Type POINT_TO_POINT, Cost: 10
Transmit Delay is 1 sec, State POINT_TO_POINT,
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Graceful Restart p2p timeout in 00:00:19
Hello due in 00:00:02
Graceful Restart helper support enabled
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 1, maximum is 1
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 10.1.1.1
Suppress hello for 0 neighbor(s)
Examples
The following display shows that the OSPF interface is enabled for Bidirectional Forwarding Detection (BFD):
Router# show ipv6 ospf interface
Serial10/0 is up, line protocol is up
Link Local Address FE80::A8BB:CCFF:FE00:6500, Interface ID 42
Area 1, Process ID 1, Instance ID 0, Router ID 10.0.0.1
Network Type POINT_TO_POINT, Cost: 64
Transmit Delay is 1 sec, State POINT_TO_POINT, BFD enabled
Timer intervals configured, Hello 10, Dead 40, Wait 40, Retransmit 5
Hello due in 00:00:07
Index 1/1/1, flood queue length 0
Next 0x0(0)/0x0(0)/0x0(0)
Last flood scan length is 1, maximum is 1
Last flood scan time is 0 msec, maximum is 0 msec
Neighbor Count is 1, Adjacent neighbor count is 1
Adjacent with neighbor 10.1.0.1
Suppress hello for 0 neighbor(s)
Related Commands
Command
Description
showipv6ospfgraceful-restart
Displays OSPFv3 graceful restart information.
show l2protocol-tunnel
To display the protocols that are tunneled on an interface or on all interfaces, use the
showl2protocol-tunnel command.
(Optional) Specifies the interface type; possible valid values are
ethernet,
FastEthernet,
gigabitethernet,
tengigabitethernet,
pos,
atm, and
ge-wan
mod/port
Module and port number.
summary
(Optional) Displays a summary of a tunneled port.
vlanvlan
(Optional) Limits the display to interfaces on the specified VLAN. Valid values are from 1 to 4094.
Command Modes
EXEC (>)
Privileged EXEC (#)
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17a)SX
The
showl2protocol-tunnelsummary command output was changed to display the following information:
Global drop-threshold setting
Up status of a Layer 2-protocol interface tunnel
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to the 12.2 SX release.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(33)SXI
This command was changed to add the optional
vlanvlan keyword and argument.
15.2(2)T
This command was integrated into Cisco IOS Release 15.2(2)T.
Usage Guidelines
After enabling Layer 2 protocol tunneling on an access or IEEE 802.1Q tunnel port by using the l2protocol-tunnel interface configuration command, you can configure some or all of these parameters:
Protocol type to be tunneled
Shutdown threshold
Drop threshold
The
showl2protocol-tunnel command displays only the ports that have protocol tunneling enabled.
The
showl2protocol-tunnelsummary command displays the ports that have protocol tunneling enabled, regardless of whether the port is down or currently configured as a trunk.
Examples
The following example is an output from the show l2protocol-tunnel command:
Router# show l2protocol-tunnel
COS for Encapsulated Packets: 5
Drop Threshold for Encapsulated Packets: 0
Port
Protocol
Shutdown Threshold
Drop Threshold
Encapsulation Counter
Decapsulation Counter
Drop Counter
Fa0/3
---
----
----
----
----
----
---
----
----
----
----
----
---
----
----
----
----
----
pagp
----
----
0
242500
lacp
----
----
24268
242640
udld
----
----
0
897960
Fa0/4
---
----
----
----
----
----
---
----
----
----
----
----
---
----
----
----
----
----
pagp
1000
----
24249
242700
lacp
----
----
24256
242660
udld
----
----
0
1344820
Gi0/3
cdp
----
----
134482
1344820
---
----
----
----
----
----
---
----
----
----
----
----
pagp
1000
----
0
242500
lacp
500
----
0
485320
udld
300
----
44899
448980
Gi0/3
cdp
----
----
134482
1344820
---
----
----
----
----
----
---
----
----
----
----
----
pagp
----
1000
0
242700
lacp
----
----
0
485220
udld
300
----
44899
448980
This example shows how to display a summary of Layer 2-protocol tunnel ports:
Router# show l2protocol-tunnel summary
COS for Encapsulated Packets:5
Drop Threshold for Encapsulated Packets:0
Port Protocol Shutdown Drop Status
Threshold Threshold
(cdp/stp/vtp) (cdp/stp/vtp)
------- ----------- ---------------- ---------------- ----------
Fa9/1 --- stp --- ----/----/---- ----/----/---- down
Fa9/9 cdp stp vtp ----/----/---- ----/----/---- up
Fa9/47 --- --- --- ----/----/---- 1500/1500/1500 down(trunk)
Fa9/48 cdp stp vtp ----/----/---- ----/----/---- down(trunk)
This example shows how to display Layer 2-protocol tunnel information on interfaces for a specific VLAN:
Router# show l2protocol-tunnel vlan 1
COS for Encapsulated Packets: 5
Drop Threshold for Encapsulated Packets: 0
Protocol Drop Counter
-------- -------------
cdp 0
lldp 0
stp 0
vtp 0
Port Protocol Thresholds Counters
Shutdown Drop Encap Decap Drop
------------------- -------- --------- --------- --------- --------- ---------
Related Commands
Command
Description
debug l2protocol-tunnel
Displays the debugging options for L2PT.
l2protocol-tunnel
Enables the protocol tunneling on an interface and specifies the type of protocol to be tunneled.
l2protocol-tunnel drop-threshold
Specifies the maximum number of packets that can be processed for the specified protocol on that interface before being dropped.
l2protocol-tunnel global drop-threshold
Enables rate limiting at the software level.
l2protocol-tunnel shutdown-threshold
Specifies the maximum number of packets that can be processed for the specified protocol on that interface in 1 second.
show l3-mgr
To display the information about the Layer 3 manager , use the
showl3-mgr command in user EXEC or privileged EXEC mode.
Interface type; possible valid values are
ethernet,
fastethernet,
gigabitethernet,
tengigabitethernet,
pos,
atm, and
ge-wan.
interface-number
Module and port number; see the “Usage Guidelines” section for valid values.
nullinterface-number
Specifies the null interface; the valid value is
0.
port-channelnumber
Specifies the channel interface; valid values are a maximum of 64 values ranging from 1 to 282.
vlanvlan-id
Specifies the VLAN; valid values are from 1 to 4094.
status
Displays status information about the Layer 3 manager.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
The
interface-number argument designates the module and port number. Valid values for
interface-number depend on the specified interface type and the chassis and module that are used. For example, if you specify a Gigabit Ethernet interface and have a 48-port 10/100BASE-T Ethernet module that is installed in a 13-slot chassis, valid values for the module number are from 1 to 13 and valid values for the port number are from 1 to 48.
The
port-channelnumbervalues from 257 to 282 are supported on the CSM and the FWSM only.
Examples
This example shows how to display the status of the Layer 3 manager:
Router#
show l3-mgr status
l3_mgr_state: 2
l3_mgr_req_q.count: 0
l3_mgr_req_q.head: 0
l3_mgr_req_q.tail: 0
l3_mgr_max_queue_count: 1060
l3_mgr_shrunk_count: 0
l3_mgr_req_q.ip_inv_count: 303
l3_mgr_req_q.ipx_inv_count: 0
l3_mgr_outpak_count: 18871
l3_mgr_inpak_count: 18871
l3_mgr_max_pending_pak: 4
l3_mgr_pending_pak_count: 0
nde enable statue: 0
current nde addr: 0.0.0.0
Router#
This example shows how to display the information about the Layer 3 manager for a specific interface:
To display the L3VPN encapsulation profile health and the underlying tunnel interface, use the showl3vpnencapsulationip command in privileged EXEC mode.
showl3vpnencapsulationip
[ profilename ]
Syntax Description
profilename
(Optional) Name of the Layer 3 encapsulation profile.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(33)SRE
This command was introduced.
Examples
The following is a sample output from the showl3vpnencapsulationip command:
Router# show l3vpn encapsulation ip tunnelencap
Profile: tunnelencap
transport ipv4 source Loopback0
protocol gre key 500
Tunnel Tunnel0 Created [OK]
Tunnel Linestate
Tunnel Transport Source Loopback0
show lacp
To display Link Aggregation Control Protocol (LACP) and multi-chassis LACP (mLACP) information, use the
showlacp command in either user EXEC or privileged EXEC mode.
(Optional) Number of the channel group. The following are valid values:
Cisco IOS 12.2 SB and Cisco IOS XE 2.4 Releases--from 1 to 64
Cisco IOS 12.2 SR Releases--from 1 to 308
Cisco IOS 12.2 SX Releases--from 1 to 496
Cisco IOS 15.1S Releases—from 1 to 564
Cisco ASR 901 Series Aggregation Services Router—from 1 to 8
counters
Displays information about the LACP traffic statistics.
internal
Displays LACP internal information.
neighbor
Displays information about the LACP neighbor.
detail
(Optional) Displays detailed internal information when used with the
internal keyword and detailed LACP neighbor information when used with the
neighbor keyword.
multi-chassis
Displays information about mLACP.
load-balance
Displays mLACP load balance information.
group
Displays mLACP redundancy group information,
number
Integer value used with the
group and
port-channel keywords.
Values from 1 to 4294967295 identify the redundancy group.
Values from 1 to 564 identify the port-channel interface.
port-channel
Displays mLACP port-channel information.
sys-id
Displays the LACP system identification. It is a combination of the port priority and the MAC address of the device
Command Modes
User EXEC (>) Privileged EXEC (#)
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Cisco IOS Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(31)SB2
This command was integrated into Cisco IOS Release 12.2(31)SB2.
12.2(33)SRB
Support for this command on the Cisco 7600 router was integrated into Cisco IOS Release 12.2(33)SRB.
Cisco IOS XE Release 2.4
This command was integrated into Cisco IOS XE Release 2.4.
12.2(33)SRE
This command was modified. The
multi-chassis,
group, and
port-channelkeywords and
number argument were added.
15.1(3)S
This command was modified. The
load-balance keyword was added.
15.1(2)SNG
This command was implemented on the Cisco ASR 901 Series Aggregation Services Router.
Usage Guidelines
Use the
show
lacp command to troubleshoot problems related to LACP in a network.
If you do not specify a value for the argument
channel-group-number, all channel groups are displayed. Values in the range of 257 to 282 are supported on the CSM and the FWSM only.
Examples
Examples
This example shows how to display the LACP system identification using the
show lacp sys-idcommand:
Device> show lacp sys-id
8000,AC-12-34-56-78-90
The system identification is made up of the system priority and the system MAC address. The first two bytes are the system priority, and the last six bytes are the globally administered individual MAC address that is associated to the system.
Examples
This example shows how to display the LACP statistics for a specific channel group:
The LACPDUs Sent and Recv columns display the LACPDUs that are sent and received on each specific interface.
The LACPDUs Pkts and Err columns display the marker-protocol packets.
The following example shows output from a
showlacpchannel-group-numbercounterscommand:
Device1# show lacp 5 counters
LACPDUs Marker Marker Response LACPDUs
Port Sent Recv Sent Recv Sent Recv Pkts Err
---------------------------------------------------------------------
Channel group: 5
Gi5/0/0 21 18 0 0 0 0 0
The following table describes the significant fields shown in the display.
Table 8 show lacp channel-group-number counters Field Descriptions
Field
Description
LACPDUs Sent Recv
Number of LACP PDUs sent and received.
Marker Sent Recv
Attempts to avoid data loss when a member link is removed from an LACP bundle.
Marker Response Sent Recv
Cisco IOS response to the Marker protocol.
LACPDUs Pkts Err
Number of LACP PDU packets transmitted and the number of packet errors.
The following example shows output from a
show lacp
internalcommand:
Device1# show lacp 5 internal
Flags: S - Device is requesting Slow LACPDUs
F - Device is requesting Fast LACPDUs
A - Device is in Active mode P - Device is in Passive mode
Channel group 5
LACP port Admin Oper Port Port
Port Flags State Priority Key Key Number State
Gi5/0/0 SA bndl 32768 0x5 0x5 0x42 0x3D
The following table describes the significant fields shown in the display.
Table 9 show lacp internal Field Descriptions
Field
Description
Flags
Meanings of each flag value, which indicates a device activity.
Port
Port on which link bundling is configured.
Flags
Indicators of device activity.
State
Activity state of the port. States can be any of the following:
Bndl--Port is attached to an aggregator and bundled with other ports.
Susp--Port is in suspended state, so it is not attached to any aggregator.
Indep--Port is in independent state (not bundled but able to switch data traffic). This condition differs from the previous state because in this case LACP is not running on the partner port.
Hot-sby--Port is in hot standby state.
Down--Port is down.
LACP port Priority
Priority assigned to the port.
Admin Key
Defines the ability of a port to aggregate with other ports.
Oper Key
Determines the aggregation capability of the link.
Port Number
Number of the port.
Port State
State variables for the port that are encoded as individual bits within a single octet with the following meaning:
bit0: LACP_Activity
bit1: LACP_Timeout
bit2: Aggregation
bit3: Synchronization
bit4: Collecting
bit5: Distributing
bit6: Defaulted
bit7: Expired
Examples
This example shows how to display internal information for the interfaces that belong to a specific channel:
Device# show lacp 1 internal
Flags: S - Device sends PDUs at slow rate. F - Device sends PDUs at fast rate.
A - Device is in Active mode. P - Device is in Passive mode.
Channel group 1
LACPDUs LACP Port Admin Oper Port Port
Port Flags State Interval Priority Key Key Number State
Fa4/1 saC bndl 30s 32768 100 100 0xc1 0x75
Fa4/2 saC bndl 30s 32768 100 100 0xc2 0x75
Fa4/3 saC bndl 30s 32768 100 100 0xc3 0x75
Fa4/4 saC bndl 30s 32768 100 100 0xc4 0x75
Device#
The following table describes the significant fields shown in the display.
Table 10 show lacp internal Field Descriptions
Field
Description
State
Current state of the port; allowed values are as follows:
bndl--Port is attached to an aggregator and bundled with other ports.
susp--Port is in a suspended state; it is not attached to any aggregator.
indep--Port is in an independent state (not bundled but able to switch data traffic. In this case, LACP is not running on the partner port).
hot-sby--Port is in a hot-standby state.
down--Port is down.
LACPDUs Interval
Interval setting.
LACP Port Priority
Port-priority setting.
Admin Key
Defines the ability of a port to aggregate with other ports.
Oper Key
Determines the aggregation capability of the link.
Port Number
Port number.
Port State
Activity state of the port.
See the Port State description in the show lacp internal Field Descriptions table for state variables.
Examples
This example shows how to display the information about the LACP neighbors for a specific port channel:
Device# show lacp 1 neighbors
Flags: S - Device sends PDUs at slow rate. F - Device sends PDUs at fast rate.
A - Device is in Active mode. P - Device is in Passive mode.
Channel group 1 neighbors
Partner Partner
Port System ID Port Number Age Flags
Fa4/1 8000,00b0.c23e.d84e 0x81 29s P
Fa4/2 8000,00b0.c23e.d84e 0x82 0s P
Fa4/3 8000,00b0.c23e.d84e 0x83 0s P
Fa4/4 8000,00b0.c23e.d84e 0x84 0s P
Port Admin Oper Port
Priority Key Key State
Fa4/1 32768 200 200 0x81
Fa4/2 32768 200 200 0x81
Fa4/3 32768 200 200 0x81
Fa4/4 32768 200 200 0x81
Device#
The following table describes the significant fields shown in the display.
Table 11 show lacp neighbors Field Descriptions
Field
Description
Port
Port on which link bundling is configured.
Partner System ID
Peer’s LACP system identification (sys-id). It is a combination of the system priority and the MAC address of the peer device.
Partner Port Number
Port number on the peer device
Age
Number of seconds since the last LACP PDU was received on the port.
Flags
Indicators of device activity.
Port Priority
Port priority setting.
Admin Key
Defines the ability of a port to aggregate with other ports.
Oper Key
Determines the aggregation capability of the link.
Port State
Activity state of the port.
See the Port State description in the show lacp internal Field Descriptions table for state variables.
If no PDUs have been received, the default administrative information is displayed in braces.
Related Commands
Command
Description
clearlacpcounters
Clears the statistics for all interfaces belonging to a specific channel group.
lacpport-priority
Sets the priority for the physical interfaces.
lacpsystem-priority
Sets the priority of the system.
show link state group
To
display the link-state group information., use the showlinkstategroup command
in user EXEC or privileged EXEC mode
.
showlinkstategroupdetail
Syntax Description
detail
Displays the detailed information about the group.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
Link State Ttracking (LST), also known as trunk failover, is a feature that binds the link state of multiple interfaces. When you configure LST for the first time, add upstream interfaces to the link state group before adding the downstream interface, otherwise the downstream interfaces would move into error-disable mode. The maximum number of link state groups configurable is 10.
Examples
The following example displays the link-state group information:
Router# enable
Router# show link state group 1
Link State Group: 1 Status: Enabled, Down
Router> show link state group detail
(Up):Interface up (Dwn):Interface Down (Dis):Interface disabled
Link State Group: 1 Status: Enabled, Down
Upstream Interfaces : Gi3/5(Dwn) Gi3/6(Dwn)
Downstream Interfaces : Gi3/1(Dis) Gi3/2(Dis) Gi3/3(Dis) Gi3/4(Dis)
Link State Group: 2 Status: Enabled, Down
Upstream Interfaces : Gi3/15(Dwn) Gi3/16(Dwn) Gi3/17(Dwn)
Downstream Interfaces : Gi3/11(Dis) Gi3/12(Dis) Gi3/13(Dis) Gi3/14(Dis)
(Up):Interface up (Dwn):Interface Down (Dis):Interface disabled
Related Commands
Command
Description
linkstatetrack
Configures the link state tracking number.
linkstategroup
Configures the link state group and interface, as either an upstream or downstream interface in the group.
show mac-address-table dynamic
To display dynamic MAC address table entries only, use the
showmac-address-tabledynamic command in privileged EXEC mode.
Cisco 2600 Series, Cisco 3600 Series, and Cisco 3700 Series Routers
showmac-address-tabledynamic
[ addressmac-addr | interfaceinterfaceinterface-number
[ all | modulenumber ] | modulenum | vlanvlan-id
[ all | modulenumber ] ]
Syntax Description
addressmac-address
(Optional) Specifies a 48-bit MAC address; valid format is H.H.H.
detail
(Optional) Specifies a detailed display of MAC address table information.
interfacetypenumber
(Optional) Specifies an interface to match; valid type values are FastEthernet and GigabitEthernet, valid number values are from 1 to 9.
interfacetype
(Optional) Specifies an interface to match; valid type values are FastEthernet and GigabitEthernet.
slot
(Optional) Adds dynamic addresses to module in slot 1 or 2.
port
(Optional) Port interface number ranges based on type of Ethernet switch network module used:
0 to 15 for NM-16ESW
0 to 35 for NM-36ESW
0 to 1 for GigabitEthernet
protocolprotocol
(Optional) Specifies a protocol. See the “Usage Guidelines” section for keyword definitions.
modulenumber
(Optional) Displays information about the MAC address table for a specific Distributed Forwarding Card (DFC) module.
vlanvlan
(Optional) Displays entries for a specific VLAN; valid values are from 1 to 1005.
begin
(Optional) Specifies that the output display begin with the line that matches the expression.
exclude
(Optional) Specifies that the output display exclude lines that match the expression.
include
(Optional) Specifies that the output display include lines that match the specified expression.
expression
Expression in the output to use as a reference point.
all
(Optional) Specifies that the output display all dynamic MAC-address table entries.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.0(7)XE
This command was introduced on Catalyst 6000 series switches.
12.2(2)XT
This command was implemented on Cisco 2600 series, Cisco 3600 series, and Cisco 3700 series routers.
12.2(8)T
This command was integrated into Cisco IOS Release 12.2(8)T on Cisco 2600 series, Cisco 3600 series, and Cisco 3700 series routers.
12.2(11)T
This command was integrated into Cisco IOS Release 12.2(11)T.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(14)SX
Support for this command was introduced on the Catalyst 6500 series switch.
12.2(33)SXH
This command was changed to support the
all keyword on the Catalyst 6500 series switch.
Usage Guidelines
Cisco 2600 Series, Cisco 3600 Series, and Cisco 3700 Series Routers
The
showmac-address-tabledynamic command output for an EtherChannel interface changes the port-number designation (for example, 5/7) to a port-group number.
Catalyst Switches
The keyword definitions for the protocol argument are:
The
showmac-address-tabledynamic command output for an EtherChannel interface changes the port-number designation (for example, 5/7) to a port-group number.
Catalyst 6500 Series Switches
The
mac-addressis a 48-bit MAC address and the valid format is H.H.H.
The optional
modulenum keyword and argument are supported only on DFC modules. The
modulenumkeyword and argument designate the module number.
Examples
The following examples show how to display all dynamic MAC address entries. The fields shown in the various displays are self-explanatory.
Examples
Router# show mac-address-table dynamic
Non-static Address Table:
Destination Address Address Type VLAN Destination Port
------------------- ------------ ---- --------------------
000a.000a.000a Dynamic 1 FastEthernet4/0
002a.2021.4567 Dynamic 2 FastEthernet4/0
Examples
Router# show mac-address-table dynamic
vlan mac address type protocol qos ports
-----+---------------+--------+---------+---+--------------------------------
200 0010.0d40.37ff dynamic ip -- 5/8
1 0060.704c.73ff dynamic ip -- 5/9
4095 0000.0000.0000 dynamic ip -- 15/1
1 0060.704c.73fb dynamic other -- 5/9
1 0080.1c93.8040 dynamic ip -- 5/9
4092 0050.f0ac.3058 dynamic ip -- 15/1
1 00e0.4fac.b3ff dynamic other -- 5/9
The following example shows how to display dynamic MAC address entries with a specific protocol type (in this case, assigned).
The following example shows the detailed output for the previous example.
Router# show mac-address-table dynamic protocol assigned detail
MAC Table shown in details
========================================
Type Always Learn Trap Modified Notify Capture Protocol Flood
-------+------------+----+--------+------+-------+--------+-----+
QoS bit L3 Spare Mac Address Age Byte Pvlan Xtag SWbits Index
-----------------+--------+--------------+--------+-----+----+------+-----
DYNAMIC NO NO YES NO NO assigned NO
Bit Not On 0 0000.0000.0000 255 4092 0 0 0x3
DYNAMIC NO NO YES NO NO assigned NO
Bit Not On 0 0050.f0ac.3059 254 4092 0 0 0x3
DYNAMIC NO NO YES NO NO assigned NO
Bit Not On 0 0010.7b3b.0978 254 1 0 0 0x108
Router#
Examples
This example shows how to display all the dynamic MAC-address entries for a specific VLAN.
Router# show mac-address-table dynamic vlan 200 all
Legend: * - primary entry
age - seconds since last seen
n/a - not aevailable
vlan mac address type learn age ports
------+----------------+--------+-----+----------+--------------------------
200 0010.0d40.37ff dynamic NO 23 Gi5/8
Router#
This example shows how to display all the dynamic MAC-address entries.
Router# show mac-address-table dynamic
Legend: * - primary entry
age - seconds since last seen
n/a - not applicable
vlan mac address type learn age ports
------+----------------+--------+-----+----------+--------------------------
* 10 0010.0000.0000 dynamic Yes n/a Gi4/1
* 3 0010.0000.0000 dynamic Yes 0 Gi4/2
* 1 0002.fcbc.ac64 dynamic Yes 265 Gi8/1
* 1 0009.12e9.adc0 static No - Router
Router#
Related Commands
Command
Description
showmac-address-tableaddress
Displays MAC address table information for a specific MAC address.
showmac-address-tableaging-time
Displays the MAC address aging time.
showmac-address-tablecount
Displays the number of entries currently in the MAC address table.
showmac-address-tabledetail
Displays detailed MAC address table information.
showmac-address-tableinterface
Displays the MAC address table information for a specific interface.
showmac-address-tablemulticast
Displays multicast MAC address table information.
showmac-address-tableprotocol
Displays MAC address table information based on protocol.
showmac-address-tablestatic
Displays static MAC address table entries only.
showmac-address-tablevlan
Displays the MAC address table information for a specific VLAN.
show mls asic
To display the application-specific integrated circuit (ASIC) version, use the
showmlsasic command in user EXEC or privileged EXEC mode.
showmlsasic
Syntax Description
This command has no arguments or keywords.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Examples
This example shows how to display the ASIC versions on a Supervisor Engine 2:
(Optional) Displays the entries for a specific destination hostname.
destinationip-address
(Optional) Displays the entries for a specific destination IP address.
detail
(Optional) Specifies a detailed output.
flow
(Optional) Specifies the flow type.
tcp |
udp
Selects the flow type.
vlanvlan-id
(Optional) Specifies the virtual local area network (VLAN) ID; valid values are from 1 to 4094.
macddestination-mac-address
(Optional) Specifies the destination MAC address.
macssource-mac-address
(Optional) Specifies the source Media Access Control (MAC) address.
modulenumber
(Optional) Displays the entries that are downloaded on the specified module; see the “Usage Guidelines” section for valid values.
sourcehostname
(Optional) Displays the entries for a specific source address.
sourceip-address
(Optional) Displays the entries for a specific source IP address.
count
(Optional) Displays the total number of MLS entries.
static
(Optional) Displays the total number of static entries.
ipv6
Displays the total number of IPv6 entries.
mpls
Displays the total number of MPLS entries.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17a)SX
This command is supported on releases prior to Release 12.2(17a)SX only.
12.2(17b)SXA
On Cisco 7600 series routers that are configured with a Supervisor Engine 720, this command is replaced by the show mls netflow ip command.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
The
static,
ipv6 and
mpls keywords are not supported on Cisco 7600 series routers that are configured with a Supervisor Engine 2.
The
interface-number argument designates the module and port number. Valid values for
interface-number depend on the specified interface type and the chassis and module that are used. For example, if you specify a Gigabit Ethernet interface and have a 48-port 10/100BASE-T Ethernet module that is installed in a 13-slot chassis, valid values for the module number are from 1 to 13 and valid values for the port number are from 1 to 48. This definition also applies to the
modulenumber keyword and argument.
When you view the output, note that a colon (:) is used to separate the fields.
Examples
This example shows how to display any MLS IP information:
Router#
show mls ip any
Displaying Netflow entries in Supervisor Earl
DstIP SrcIP Prot:SrcPort:DstPort Src i/f:AdjPtr
--------------------------------------------------------------------
Pkts Bytes Age LastSeen Attributes
---------------------------------------------------
0.0.0.0 0.0.0.0 0 :0 :0 0 : 0x0
82 3772 1329 20:46:03 L3 - Dynamic
Router#
This example shows how to display MLS information on a specific IP address:
Router#
show mls ip destination 172.20.52.122
Displaying Netflow entries in Supervisor Earl
DstIP SrcIP Dst i/f:DstMAC Pkts Bytes
-----------------------------------------------------------------------
SrcDstPorts SrcDstEncap Age LastSeen
----------------------------------------
172.20.52.122 0.0.0.0 5 : 00e0.4fac.b3ff 684 103469
Fa5/9,Fa5/9 ARPA,ARPA 281 07:17:02
Number of Entries Found = 1
Router#
This example shows how to display MLS information on a specific flow type:
Router# show mls ip flow udp
Displaying Netflow entries in Supervisor Earl
DstIP SrcIP Prot:SrcPort:DstPort Src i/f:AdjPtr
--------------------------------------------------------------------
Pkts Bytes Age LastSeen Attributes
---------------------------------------------------
0.0.0.0 0.0.0.0 0 :0 :0 0 : 0x0
78 3588 1259 20:44:53 L3 - Dynamic
Router#
This example shows how to display detailed MLS information:
(Optional) Displays the entries for a specific destination
network address.
interface
(Optional) Specifies the interface.
interface
(Optional) Interface type; possible valid values are
ethernet,
fastethernet,
gigabitethernet,
tengigabitethernet,
pos,
atm, and
ge-wan.
interface-number
(Optional) Module and port number; see the “Usage
Guidelines” section for valid values.
vlanvlan-id
(Optional) Specifies the virtual local area network (VLAN)
ID; valid values are from 1 to 4094.
macddestination-mac-address
(Optional) Specifies the destination Media Access Control
(MAC) address.
macssource-mac-address
(Optional) Specifies the source MAC address.
modulenumber
(Optional) Displays the entries that are downloaded on the
specified slot; see the “Usage Guidelines” section for valid values.
sourcehostname
(Optional) Displays the entries for a specific source
address.
sourceipx-network
(Optional) Displays the entries for a specific destination
network address.
detail
(Optional) Displays the detailed list of entries.
count
(Optional) Displays the total number of MLS entries.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was
extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release
12.2(33)SRA.
Usage Guidelines
This command is not supported on Cisco 7600 series routers that are
configured with a Supervisor Engine 720 with a PFC2.
When you enter the
ipx-network value, the format is N.H.H.H.
When you enter the
destination-mac-address value, the format for
the 48-bit MAC address is H.H.H.
The
interface-number argument designates the
module and port number. Valid values for
interface-number depend on the specified
interface type and the chassis and module used. For example, if you specify a
Gigabit Ethernet interface and have a 48-port 10/100BASE-T Ethernet module
installed in a 13-slot chassis, valid values for the module number are from 1
to 13 and valid values for the port number are from 1 to 48. These valid values
also apply when entering the
modulenumber keyword and argument.
Examples
This example shows how to display MLS IPX information:
Router#
show mls ipx
DstNet-DstNode SrcNet Dst i/f:DstMAC Pkts Bytes
-----------------------------------------------------------------------
SrcDstPorts SrcDstEncap Age LastSeen
----------------------------------------
Number of Entries Found = 0
Router#
This example shows how to display the total number of MLS entries:
Router#
show mls ipx count
Number of shortcuts = 66
Router#
Related Commands
Command
Description
mlsipx
Enables MLS IPX on the interface.
showmlsasic
display the application-specific integrated circuit (ASIC)
version
showmlsdf-table
Displays information about the DF table.
showmlsip
Displays the Multilayer Switching (MLS) IP information.
showmlsqos
Displays Multilayer Switching (MLS) quality of service
(QoS) information
showmlsstatistics
Displays the Multilayer Switching (MLS) statistics for the
Internet Protocol (IP)
show mobility
To display information about the Layer 3 mobility and the wireless network, use the
showmobility command in privileged EXEC mode.
showmobility
{ ap [ip-address] | mn
[ ipip-address ] | macmac-address | networknetwork-id | status }
Syntax Description
ap
Displays information about the access point.
ip-address
(Optional) IP address.
mn
Displays information about the mobile node.
ipip-address
(Optional) Displays information about the IP database thread.
macmac-address
Displays information about the MAC database thread.
networknetwork-id
Displays information for a specific wireless network ID.
status
Displays status information.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.2(18)SXD
This command was introduced on the Supervisor Engine 720.
12.2(18)SXD3
The output of this command was changed to include the TCP adjust-mss status.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
This command is supported on Cisco 7600 series routers that are configured with a WLSM only.
Examples
This example shows how to display information about the access point:
Router# show mobility
ap
AP IP Address AP Mac Address Wireless Network-ID
--------------- -------------- -------------------
10.1.1.2 000d.29a2.a852 101 102 109 103
This example shows how to display information about the access points for a specific network ID:
Router# show mobility
ap 172.16.1.2 detail
IP Address : 172.16.1.2
MAC Address : 000d.29a2.a852
Participating Wireless Tunnels: 101, 102, 109, 103
Registered Mobile Nodes on AP {172.16.1.2, 000d.29a2.a852} :
MN Mac Address MN IP Address AP IP Address Wireless Network-ID
-------------- --------------- --------------- -------------------
000a.8afa.85c9 10.1.3.11 172.16.1.2 103
000d.bdb7.83f7 10.1.2.11 172.16.1.2 102
000d.bdb7.83fb 10.1.1.11 172.16.1.2 101
Router# show mobility
network-id 101
Wireless Network ID : 101
Wireless Tunnel Source IP Address : 10.1.1.1
Wireless Network Properties : Trusted
Wireless Network State : Up
Registered Access Point on Wireless Network 101:
AP IP Address AP Mac Address Wireless Network-ID
--------------- -------------- -------------------
176.16.1.2 000d.29a2.a852 101 102 109 103
Registered Mobile Nodes on Wireless Network 101:
MN Mac Address MN IP Address AP IP Address Wireless Network-ID
-------------- --------------- --------------- -------------------
000d.bdb7.83fb 10.1.1.11 176.16.1.2 101
Router# show mobility
status
WLAN Module is located in Slot: 4 (HSRP State: Active) LCP
Communication status : up
MAC address used for Proxy ARP: 0030.a349.d800
Number of Wireless Tunnels : 1
Number of Access Points : 2
Number of Mobile Nodes : 0
Wireless Tunnel Bindings:
Src IP Address Wireless Network-ID Flags
--------------- ------------------- -------
10.1.1.1 101 B
Flags: T=Trusted, B=IP Broadcast enabled, A=TCP Adjust-mss enabled
Related Commands
Command
Description
mobility
Configures the wireless mGRE tunnels.
show module
To display the module status and information, use the
show module command in user EXEC or
privileged EXEC mode.
showmodule
[ mod-num | all | provision | version ]
Syntax Description
mod-num
(Optional) Number of the module.
all
(Optional) Displays the information for all modules.
provision
(Optional) Displays the status about the module
provisioning.
version
(Optional) Displays the version information.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor
Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was
extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release
12.2(33)SRA.
Usage Guidelines
In the Mod Sub-Module fields, the
showmodule command displays the supervisor engine
number but appends the uplink daughter card’s module type and information.
Entering the
showmodule command with no arguments is the same as
entering the
showmoduleall command.
Examples
This example shows how to display information for all modules on a
Cisco 7600 series router that is configured with a Supervisor Engine 720:
Router#
show module
Mod Ports Card Type Model Serial No.
--- ----- -------------------------------------- ------------------ -----------
1 48 CEF720 48 port 10/100/1000mb Ethernet WS-X6748-GE-TX SAL0843557C
2 48 48-port 10/100/1000 RJ45 EtherModule WS-X6148A-GE-45AF SAL1109HZW9
3 48 48-port 10/100/1000 RJ45 EtherModule WS-X6148A-GE-45AF SAL1114KYZ7
4 48 48 port 10/100 mb RJ45 WS-X6348-RJ-45 SAL0543DGZ1
6 2 Supervisor Engine 720 (Active) WS-SUP720-3B SAL1016KASS
7 48 48-port 10/100 mb RJ45 WS-X6148-45AF SAL08321X1H
8 4 CEF720 4 port 10-Gigabit Ethernet WS-X6704-10GE SAL08528ADQ
9 48 48-port 100FX SFP Ethernet Module WS-X6148-FE-SFP SAD090208MB
Mod MAC addresses Hw Fw Sw Status
--- ---------------------------------- ------ ------------ ------------ -------
1 0012.005c.86e0 to 0012.005c.870f 2.1 12.2(14r)S5 12.2(33)SXH Ok
2 001b.0ce4.9fb0 to 001b.0ce4.9fdf 2.2 8.4(1) 8.7(0.22)SXH Ok
3 001b.534f.0540 to 001b.534f.056f 2.2 8.4(1) 8.7(0.22)SXH Ok
4 0007.4f6c.69f8 to 0007.4f6c.6a27 5.0 5.4(2) 8.7(0.22)SXH Ok
6 0017.9441.44cc to 0017.9441.44cf 5.2 8.4(2) 12.2(33)SXH Ok
7 0011.bb0e.c260 to 0011.bb0e.c28f 1.1 5.4(2) 8.7(0.22)SXH Ok
8 0012.da89.a43c to 0012.da89.a43f 2.0 12.2(14r)S5 12.2(33)SXH Ok
9 0030.f273.baf0 to 0030.f273.bb1f 3.0 8.4(1) 8.7(0.22)SXH Ok
Mod Sub-Module Model Serial Hw Status
---- --------------------------- ------------------ ----------- ------- -------
1 Centralized Forwarding Card WS-F6700-CFC SAL08363HL6 2.0 Ok
2 IEEE Voice Daughter Card WS-F6K-48-AF SAL1108HRB1 2.3 Ok
3 IEEE Voice Daughter Card WS-F6K-48-AF SAL1114KV3P 2.3 Ok
4 Inline Power Module WS-F6K-VPWR 1.0 Ok
6 Policy Feature Card 3 WS-F6K-PFC3B SAL1015K00Q 2.3 Ok
6 MSFC3 Daughterboard WS-SUP720 SAL1016KBY3 2.5 Ok
7 IEEE Voice Daughter Card WS-F6K-FE48-AF SAL08311GGL 1.1 Ok
8 Centralized Forwarding Card WS-F6700-CFC SAL0902040K 2.0 Ok
Mod Online Diag Status
---- -------------------
1 Bypass
2 Bypass
3 Bypass
4 Bypass
6 Bypass
7 Bypass
8 Bypass
9 Bypass
Router#
This example shows how to display information for a specific module:
Router#
show module 2
Mod Ports Card Type Model Serial No.
--- ----- -------------------------------------- ------------------ -----------
5 2 Supervisor Engine 720 (Active) WS-SUP720-BASE SAD0644030K
Mod MAC addresses Hw Fw Sw Status
--- ---------------------------------- ------ ------------ ------------ -------
5 00e0.aabb.cc00 to 00e0.aabb.cc3f 1.0 12.2(2003012 12.2(2003012 Ok
Mod Sub-Module Model Serial Hw Status
--- --------------------------- --------------- --------------- ------- -------
5 Policy Feature Card 3 WS-F6K-PFC3 SAD0644031P 0.302 Ok
5 MSFC3 Daughtercard WS-SUP720 SAD06460172 0.701
Mod Online Diag Status
--- -------------------
5 Not Available
Router#
This example shows how to display version information:
Displays the information about the environmental alarm.
showfmsummary
Displays a summary of FM Information.
showenvironmentstatus
Displays the information about the operational FRU status.
show network-clocks
To display the current configured and active network clock sources, use theshownetwork-clocks command in privileged EXEC mode.
shownetwork-clocks
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
11.1
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
12.2(33)SRD1
This command was introduced to display BITS clock information for the 7600-ES+ITU-2TG and 7600-ES+ITU-4TG.
Usage Guidelines
On the Cisco MC3810, this command applies to Voice over Frame Relay, Voice over ATM, and Voice over HDLC. The Cisco MC3810 has a background task that verifies whether a valid clocking configuration exists every 120 seconds. If this task detects an error, you will be reminded every 120 seconds until the error is corrected. A clocking configuration error may be generated for various reasons. Using the
shownetwork-clocks command, you can display the clocking configuration status.
On the Cisco 7600 series routers, this command applies to the following:
The clock source from the POS SPAs on the SIP-200 and the SIP-400.
The 24-Port Channelized T1/E1 ATM CEoP SPA and the 1-Port Channelized OC-3 STM1 ATM CEoP SPA on the SIP-400.
The 7600-ES+ITU-2TG and 7600-ES+ITU-4TG line cards.
Examples
The following is sample output from the
shownetwork-clocks EXEC command:
Router# show network-clocks
Priority 1 clock source: ATM3/0/0
Priority 2 clock source: System clock
Priority 3 clock source: System clock
Priority 4 clock source: System clock
Current clock source:ATM3/0/0, priority:1
The following is sample output from the
shownetwork-clocks command on the Cisco MC3810:
Router# show network-clocks
Priority 1 clock source(inactive config): T1 0
Priority 1 clock source(active config) : T1 0
Clock switch delay: 10
Clock restore delay: 10
T1 0 is clocking system bus for 9319 seconds.
Run Priority Queue: controller0
In this display, inactive configuration is the new configuration that has been established. Active configuration is the run-time configuration. Should an error be made in the new configuration, the inactive and active configurations will be different. In the previous example, the clock priority configuration is valid, and the system is being clocked as indicated.
The following is another sample output from the
shownetwork-clocks command:
Router# show network-clocks
Priority 1 clock source(inactive config) : T1 0
Priority 2 clock source(inactive config) : T1 1
Priority 1 clock source(active config) : T1 0
Clock switch delay: 10
Clock restore delay: 10
T1 0 is clocking system bus for 9319 seconds.
Run Priority Queue: controller0
In this display, the new clocking configuration has an error for controller T1 1. This is indicated by checking differences between the last valid configuration (active) and the new proposed configuration (inactive). The error may result from hardware (the system controller board or MFT) unable to support this mode, or controller T1 1 is currently configured as “clock source internal.”
Since the active and inactive configurations are different, the system will periodically display the warning message about the wrong configuration.
The following is another sample output from the
shownetwork-clocks command for the 7600-ES+ITU-2TG or 7600-ES+ITU-4TG:
Router# show network-clocks
Active source = Slot 1 BITS 0
Active source backplane reference line = Primary Backplane Clock
Standby source = Slot 9
Standby source backplane reference line = Secondary Backplane Clock
(Standby source not driving backplane clock currently)
All Network Clock Configuration
---------------------------------
Priority Clock Source State Reason
1 POS3/0/1 Valid but not present
2 Slot 1 BITS 0 Valid
3 Slot 9 Valid
Current operating mode is Revertive
Current OOR Switchover mode is Switchover
There are no slots disabled from participating in network clocking
BITS Port Configuration
-------------------------
Slot Port Signal Type/Mode Line Build-Out Select
1 0 T1 ESF DSX-1 (533 to 655 feet)
Related Commands
Command
Description
clocksource
Specifies the interface clock source type.
network-clock
Configures BITS port signaling types.
network-clockselect
Selects a source of network clock.
network-clock-select(ATM)
Establishes the sources and priorities of the requisite clocking signals for an ATM-CES port adapter.
showplatformhardwarenetwork-clocks
Displays network clocks for an ES+ line card.
show pagp
To display port-channel information, use the
showpagp command in user EXEC or privileged EXEC mode.
(Optional) Channel-group number; valid values are a maximum of 64 values from 1 to 282.
counters
Displays the traffic information.
internal
Displays the internal information.
neighbor
Displays the neighbor information.
pgroup
Displays the active port channels.
Command Default
This command has no default settings.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.2(14)SX
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Release 12.2(17d)SXB.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
Usage Guidelines
You can enter any
showpagp command to display the active port-channel information. To display the nonactive information, enter the
showpagp command with a group.
The
port-channelnumbervalues from 257 to 282 are supported on the CSM and the FWSM only.
Examples
This example shows how to display information about the PAgP counters:
This example shows how to display internal PAgP information:
Router# show pagp 1 internal
Flags: S - Device is sending Slow hello. C - Device is in Consistent state.
A - Device is in Auto mode.
Timers: H - Hello timer is running. Q - Quit timer is running.
S - Switching timer is running. I - Interface timer is running.
Channel group 1
Hello Partner PAgP Learning
Port Flags State Timers Interval Count Priority Method
Fa5/4 SC U6/S7 30s 1 128 Any
Fa5/5 SC U6/S7 30s 1 128 Any
Router#
This example shows how to display PAgP-neighbor information for all neighbors:
Router# show pagp neighbor
Flags: S - Device is sending Slow hello. C - Device is in Consistent state.
A - Device is in Auto mode. P - Device learns on physical port.
Channel group 1 neighbors
Partner Partner Partner Partner Group
Port Name Device ID Port Age Flags Cap.
Fa5/4 JAB031301 0050.0f10.230c 2/45 2s SAC 2D
Fa5/5 JAB031301 0050.0f10.230c 2/46 27s SAC 2D
Channel group 2 neighbors
Partner Partner Partner Partner Group
Port Name Device ID Port Age Flags Cap.
Fa5/6 JAB031301 0050.0f10.230c 2/47 10s SAC 2F
Fa5/7 JAB031301 0050.0f10.230c 2/48 11s SAC 2F
Channel group 1023 neighbors
Partner Partner Partner Partner Group
Port Name Device ID Port Age Flags Cap.
Channel group 1024 neighbors
Partner Partner Partner Partner Group
Port Name Device ID Port Age Flags Cap.
Router#
Related Commands
Command
Description
pagplearn-method
Learns the input interface of the incoming packets.
pagpport-priority
Selects a port in hot standby mode.
show pas caim
To show debug information about the data compression Advanced Interface Module (CAIM) daughter card, use the
showpascaimcommand in user EXEC or privileged EXEC mode.
Displays current content of the Direct Memory Access (DMA) ring buffer.
dmaelement-number
Displays registers of the Jupiter DMA controller.
coprocessorelement-number
Displays registers of the Hifn 9711 compression coprocessor.
statselement-number
Displays statistics that describes operation of the data compression Advanced Interface Module (AIM).
cnxt_tableelement-number
Displays the context of the specific data compression AIM element.
page_tableelement-number
Displays the page table for each CAIM element.
Command Modes
User EXEC Privileged EXEC
Command History
Release
Modification
12.0(2)T
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
Usage Guidelines
This command displays performance statistics that describe the operation of the CAIM. This command is primarily intended for engineering debug, but it can also be useful to Cisco support personnel and to Cisco customers in troubleshooting network problems. The table below lists the output values for this command.
Table 12 show pas caim Output Values and Descriptions
Value
Description
uncomp paks in
Number of packets containing uncompressed data input to the CAIM for compression.
comp paks out
Number of packets containing uncompressed data that were successfully compressed.
comp paks in
Number of packets containing compressed data input to the CAIM for compression.
uncomp paks out
Number of packets containing compressed data that were successfully decompressed.
uncomp bytes in / comp bytes out
Summarizes the compression performance of the CAIM. The “uncomp bytes in” statistic gives the total number of uncompressed bytes submitted to the CAIM for compression. The “Comp bytes out” statistic gives the resulting number of compressed bytes output by the CAIM. If one forms the ratio of “uncomp bytes in” to “comp bytes out”, one obtains the average compression ratio achieved by the CAIM.
comp bytes in / uncomp bytes out
Summarizes the decompression performance of the CAIM. The “comp bytes in” statistic gives the total number of compressed bytes submitted to the CAIM for decompression. The “uncomp bytes out” statistic gives the resulting number of uncompressed bytes output by the CAIM. The average decompression ratio achieved can be computed as the ratio of “uncomp bytes out” to “comp bytes in”.
Note that each packet submitted for compression or decompression has a small header at the front which is always clear data and hence never compressed nor decompressed. The “comp bytes in / uncomp bytes out” and “uncomp bytes in / comp bytes out” statistics do not include this header.
uncomp paks/sec in
A time average of the number of packets per second containing uncompressed data submitted as input to the CAIM for compression. It is computed as the ratio of the “uncomp paks in” statistic to the “seconds since last clear” statistic.
comp paks/sec out
A time average of the number of packets per second containing uncompressed data which were successfully compressed by the CAIM. It is computed as the ratio of the “comp paks out” statistic to the “seconds since last clear” compressed by the CAIM. It is computed as the ratio of the “comp paks out” statistic to the “seconds since last clear” statistic.
comp paks/sec in
A time average of the number of packets per second containing compressed data submitted as input to the CAIM for decompression. It is computed as the ratio of the “comp paks in” statistic to the “seconds since last clear” statistic.
uncomp paks/sec out
A time average of the number of packets per second containing compressed data which were successfully decompressed by the CAIM. It is computed as the ratio of the “uncomp paks out” statistic to the “seconds since last clear” statistic.
Note that the “uncomp paks/sec in”, “comp paks/sec out”, “comp paks/sec in”, and “uncomp paks/sec out” statistics are averages over the entire time since the last “clear count” command was issued. This means that as time progresses, these statistics become averages over an ever larger time interval. As time progresses, these statistics become ever less sensitive to current prevailing conditions. Note also that the “uncomp paks in”, “comp paks out”, “comp paks in”, and “uncomp paks out” statistics are 32-bit counters and can roll over from 0xffff ffff to 0. When they do so, the “uncomp paks/sec in”, “comp paks/sec out”, “comp paks/sec in”, and “uncomp paks/sec out” statistics can be rendered meaningless. It is therefore recommend that one issue a “clear count” command before sampling these statistics.
uncomp bits/sec in
A time average of the number of bits per second of uncompressed data which were submitted to the CAIM for compression. It is computed as the ratio of the “uncomp bytes in” statistic, times 8, to the “seconds since last clear” statistic.
comp bits/sec out
A time average of the number of bits per second of uncompressed data which were successfully compressed by the CAIM. It is computed as the ratio of the “comp bytes out” statistic, times 8, to the “seconds since last clear” statistic.
comp bits/sec in
A time average of the number of bits per second of compressed data which were submitted to the CAIM for decompression. It is computed as the ratio of the “comp bytes in” statistic, times 8, to the “seconds since last clear” statistic.
uncomp bits/sec out
A time average of the number of bits per second of compressed data which were successfully decompressed by the CAIM. It is computed as the ratio of the “uncomp bytes in” statistic, times 8, to the “seconds since last clear” statistic.
Note again that these “bits/sec” statistics are time averages over the “seconds since last clear” statistics, and therefore become less and less sensitive to current conditions as time progresses. Also, these “bits/sec” statistics are computed from 32-bit counters, and when the counters roll over from the maximum 32-bit value to 0, the “bits/sec” statistics become inaccurate. It is again recommended that one issue the “clear count” command before sampling the “bits/sec” statistics.
The remaining statistics summarize operational state and error conditions encountered by the CAIM, and have the following interpretations:
holdq
Gives the number of packets occupying the “hold queue” of the CAIM. The hold queue is a holding area, or “overflow” area, for packets to be processed by the CAIM. Normally, the CAIM is fast enough that no overflow into the hold queue occurs, and so normally this statistic should show zero.
hw_enable
Flag indicating if the CAIM is disabled or not. Zero implies disabled; one implies enabled. The CAIM can become disabled if certain fatal hardware error conditions are detected. It can be reenabled by issuing the
clearaimelement-number command.
src_limited
Flag indicating if the CAIM is in “source limited” mode. In source limited mode, the CAIM can only process a single command at a time. In non source limited mode, the CAIM can process several commands at a time using a pipeline built into the 9711 coprocessor. Note that the normal mode of operation is “non-source limited”, and there is no command to place the CAIM in “source limited” mode. Hence, this statistic should always read zero.
num cnxts
Gives the number of “contexts” which are currently open on the CAIM. Each interface configured for compression opens two contexts, one for each direction of data transfer.
no data
Counts the number of times in which the CAIM performed either a compress or decompression operation, and the output data length was reported with a length of zero. In normal operation, this statistic should always read zero. A nonzero value is an indication of a malfunctioning CAIM.
drops
Counts the total number of times in which the CAIM was forced to drop a packet it was asked to compress or decompress. This can happen for a number of reasons, and the remaining statistics summarize these reasons. This statistic indicates that the CAIM is being overloaded with requests for compression/decompression.
nobuffers
Counts the total number of times the CAIM needed to allocate memory for buffers but could not obtain memory. The CAIM allocates memory for buffers for holding the results of compression or decompression operations. In normal operation, there is plenty of memory available for holding CAIM results. This statistic, if nonzero, indicates that there is a significant backup in memory, or perhaps a memory leak.
enc adj errs
Each packet compressed or decompressed involves an adjustment of the encapsulation of the packet between the LZS-DCP, FRF9, or MPPC encapsulation used to transport compressed packets to the standard encapsulation used to transport clear data. This statistic counts the number of times this encapsulation adjustment failed. In normal operation, this statistic should be zero. A nonzero value indicates that we are short in a specific memory resource referred to as “paktypes”, and that packets are being dropped because of this shortage.
fallbacks
Number of times the data compression AIM card could not use its pre-allocated buffers to store compression results and had to “fallback” to using a common buffer pool.
no replace
Each time a compression or decompression operation is completed and the resultant data fill up a buffer, the CAIM software allocates a new buffer to replace the buffer filled. If no buffers are available, then the packet involved in this operation is dropped and the old buffer reused. This statistic thus represents the number of times such an allocation failure occurred. In normal operation there is plenty of memory available for these buffers. A nonzero value for this statistic is thus a serious indication of a memory leak or other backup in buffer usage somewhere in the system.
num seq errs
This statistic is incremented when the CAIM produces results in a different order than that in which the requests were submitted. Packets involved in such errors are dropped. A nonzero value in this statistic indicates a serious malfunction in the CAIM.
num desc errs
Incremented when the CAIM reports error in a compression or decompression operation. Such errors are most likely bus errors, and they indicate a serious malfunction in the CAIM.
cmds complete
Reports the number of compression/decompression commands completed. This statistic should steadily increase in normal operation (assuming that the CAIM is continuously being asked to perform compression or decompression). If this statistic is not steadily increasing or decreasing when a steady stream of compression/decompression is expected, this is an indication of a malfunctioning CAIM.
bad reqs
Reports the number of compression/decompression requests that the CAIM software determined it could not possibly handle. This occurs only if a severely scattered packet (with more than 64 “particles”, or separate buffers of data) is handed to the CAIM to compress or decompress. This statistic should not increment during normal operation. A nonzero value indicates a software bug.
dead cntxts
Number of times a packet was successfully compressed or decompressed, only to find that the software “context”, or stream sourcing the packet, was no longer around. In such a case the packet is dropped. This statistic can be incremented at times when a serial interface is administratively disabled. If the timing is right, the CAIM may be right in the middle of operating on a packet from that interface when the disable takes effect. When the CAIM operation completes, it finds that the interface has been disabled and all “compression contexts” pertaining to that interface have been deleted. Another situation in which this can occur is when a Frame Relay DLC goes down. This is a normal and tolerable. If this statistic is incrementing when no such situations exist, it is an indication of a software bug.
no paks
If a packet to be compressed or decompressed overflows into the hold queue, then it must undergo an operation called “reparenting”. This involves the allocation of a “paktype” structure for the packet. If no paktype structures are available, then the packet is dropped and this statistic is incremented. A nonzero value of this statistic indicates that the CAIM is being overtaxed, that is, it is being asked to compress/decompress at a rate exceeding its capabilities.
enq errors
Closely related to the “no paks” statistic. The hold queue for the CAIM is limited in length, and if the hold queue grows to this length, no further packets may be placed on it. A nonzero value of this statistic therefore also indicates that the CAIM is being overtaxed.
rx pkt drops
Contains the total number of packets dropped because of “no paks” or “enq errors”, which were destined to be decompressed.
tx pkt drops
Contains the total number of packets dropped because of “no paks” or “enq errors”, which were destined to be compressed
dequeues
Indicates the total number of packets which were removed from the CAIM hold queue when the CAIM became available for servicing its hold queue.
requeues
Indicates the total number of packets that were removed from the hold queue, only to find that the necessary CAIM resources were not available (it is not possible to determine whether CAIM resources are available until the packet is dequeued). Such packets are requeued onto the hold queue, with order in the queue preserved.
drops disabled
Indicates the total number of packets which were submitted for compression or decompression, but that were dropped because the CAIM was disabled.
clears
Indicates the number of times the CAIM was reset using the
clearaimelement-numbercommand.
# ints
Indicates the number of interrupts serviced by the CAIM software. This statistic should steadily increase (assuming that the CAIM workload is steady). If this statistic is not incremented when expected, it indicates a severe CAIM malfunction.
# purges
Indicates the total number of times the compression history for a session had to be purged. This statistic is incremented a couple of times at startup. Thereafter, any increase in this statistic is an indication that the other side of the serial link detected bad data or gaps in the compressed packets being passed to it, and hence signalled a request to purge compression history in order to get back in synchronization. This can indicate that the CAIM is being overtaxed or that the serial interface is overtaxed and being forced to drop output packets.
no cnxts
Indicates the total number of times a request was issued to open a context, but the CAIM could not support any more contexts. Recall that two contexts are required for each interface configured for compression.
bad algos
Indicates the total number of times a request was issued to open a context for a compression algorithm not supported by the CAIM. Recall that the CAIM supports the LZS and MPPC algorithms only.
no crams
Indicates the total number of times a request was issued to open a context but there was insufficient compression DRAM to open another context. The CAIM software is set up to run out of contexts before it runs out of compression DRAM, so this statistic should always be zero.
bad paks
Indicates the total number of times a packet was submitted for compression or decompression to the CAIM, but the packet had an invalid size.
# opens
Indicates the total number of times a context was opened.
# closes
Indicates the total number of times a context was closed.
# hangs
Indicates the total number of times a CAIM appeared hung up, necessitating a clear of the CAIM.
Examples
The
showpascaimringselement-number command displays the current state of the DMA ring buffers maintained by the CAIM software. These rings feed the CAIM with data and commands. It is intended for an engineering debug of the compression AIM. It produces the following output:
The table below describes the significant fields shown in the display.
Table 13 show pas caim rings Field Descriptions
Field
Description
CAIM Command Ring
Feeds commands to the CAIM.
command ring address
Address of the command ring.
Command Ring Stack
Ring that feeds additional commands to the CAIM.
command ring stack address
Address of the command ring stack.
Command Ring Shadow
Software ring that stores additional information about each command.
command ring shadow address
Address of the command ring shadow.
Command Ring Head
Index into the Source Ring, specifying where the next entry will be extracted from.
Command Ring Tail
Index into the Source Ring, specifying where the next entry will be inserted.
CAIM Source Ring
Feeds information about input data to the CAIM.
source ring address
Address of the source ring.
Source Ring Shadow
Ring that contains additional information about each source buffer.
source ring shadow address
Address of the source ring shadow.
Source Ring Head
Specifies where the next entry will be extracted from.
Source Ring Tail
Specifies where the next entry will be inserted.
CAIM Results Ring
Receives information about each CAIM command as it is completed.
results ring address
Address of the results ring.
Results Ring Stack
Ring that receives additional information about each completed command.
results ring stack address
Address of the results ring stack.
Results Ring Head
Specifies where the next entry will be extracted from.
Results Ring Tail
Specifies where the next entry will be inserted.
CAIM Dest Ring
Holds information about the buffers available to the CAIM for output data.
dest ring address
Address of the dest ring.
Dest Ring Shadow
Ring that holds additional information about each output buffer.
dest ring shadow address
Address of the dest ring shadow.
Dest Ring Head
Index into the Source Ring, specifying where the next entry will be extracted from.
Dest Ring Tail
Index into the Source Ring, specifying where the next entry will be inserted.
The remaining fields describe each output data buffer.
dest
Address of a so-called descriptor, used by the Jupiter DMA engine.
flags
Contains flags describing attributes of the buffer.
dptr
Displays the actual address of the output buffer.
part
Displays the address of the corresponding particle type structure, a software-defined structure that describes a buffer when it is a component of a network data buffer.
The
show pas caim dma
element-numbercommand displays the registers of the Jupiter DMA Controller. These registers control the operation of the Jupiter DMA Controller. This command is intended for Engineering debug of the CAIM. You can find detailed descriptions of the various fields in the Jupiter DMA Controller specification. It produces the following output:
Router# show pas caim dma 0
Jupiter DMA Controller Registers: (0x40200000
Cmd Ring: 0x01A2BCA8 Src Ring: 0x01A2C9A8
Res Ring: 0x01A2C328 Dst Ring: 0x01A2CBE8
Status/Cntl: present: 0x80808084 last int: 0x80808084
Inten: 0x10100000 config: 0x00100003
Num DMA ints: 143330469
The show pas caim compressor element-number command displays the registers of the Hifn 9711 compression coprocessor. These registers control the operation of the Hifn 9711 part. This command is intended for engineering to debug the CAIM. Detailed descriptions of the various fields may be found in the Hifn 9711 data book. It produces the following output:
Router# show pas caim compressor 0
Hifn9711 Data Compression Coprocessor Registers (0x40201000):
Config: 0x000051D4 Inten: 0x00000E00
Status: 0x00004000 FIFO status: 0x00004000
FIFO config: 0x00000101
The table below describes the fields shown in the preceding display.
Table 14 show pas caim compressor Field Descriptions
Field
Description
Hifn9711 Data Compression Coprocessor Registers
Controls the operation of the Hifn 9711 part.
registers address
Address of the registers in the address space of the processor.
Config
Displays the current contents of the 9711 configuration register.
Inten
Displays the contents of the 9711 interrupt enable register.
Status
Displays the contents of the 9711 status register.
FIFO status
Contents of the 9711 FIFO Status register.
FIFO config
Contents of the 9711 FIFO Config register.
The show pas caim cnxt_table element-number command displays the context table for the specified CAIM element. The context table is a table of information concerning each compression context. It produces the following output:
The table below describes the fields shown in the preceding display.
Table 15 show pas caim cnxt_table Fields Descriptions
Field
Description
Context
Numeric internal reference for the compression context.
Type
Gives the type of context:
Compr--compression context
Decomp--decompression context
Algo
Gives the compression algorithm used:
Stac
Mppc
Hdrlen
Gives the number of bytes in the compression header for each compressed packet.
History
Gives the 16-KB page number in compression RAM for the context.
Callback
Gives an internal numeric reference for a control structures or procedure to facilitate debugging.
Shutdown
Gives an internal numeric reference for a control structures or procedure to facilitate debugging.
Comp_db
Gives an internal numeric reference for a control structures or procedure to facilitate debugging.
idb
Gives an internal numeric reference for a control structures or procedure to facilitate debugging.
idb
Gives an internal numeric reference for a control structures or procedure to facilitate debugging.
Purge
Indicates whether the compression context has been flagged to have its history purged.
The show pas caim page_table element-number command displays the page table for the selected CAIM element. The page table is a table of entries describing each page in compression RAM. It produces the following output:
Router# show pas caim page_table 0
CAIM0 Page Table
Page 0x0000 Comp cnxt: 8104F320 Decmp cnxt: 8104F340 Algo: Stac
The table below describes the fields shown in the preceding display.
Table 16 show pas caim page_table Field Descriptions
Field
Description
Page
16 KB page number of the page.
Comp cnxt
Contains an internal numeric reference to the context structures using this page.
Decmp cnxt
Contains an internal numeric reference to the context structures using this page.
Algo
Gives the compression algorithm used:
Stac
Mppc
The following example shows statistics of an active data compression AIM session:
Router# show pas caim stats 0
CompressionAim0
ds:0x80F56A44 idb:0x80F50DB8
422074 uncomp paks in --> 422076 comp paks out
422071 comp paks in --> 422075 uncomp paks out
633912308 uncomp bytes in--> 22791798 comp bytes out
27433911 comp bytes in --> 633911762 uncomp bytes out
974 uncomp paks/sec in--> 974 comp paks/sec out
974 comp paks/sec in --> 974 uncomp paks/sec out
11739116 uncomp bits/sec in--> 422070 comp bits/sec out
508035 comp bits/sec in --> 11739106 uncomp bits/sec out
433 seconds since last clear
holdq: 0 hw_enable: 1 src_limited: 0 num cnxts: 4
no data: 0 drops: 0 nobuffers: 0 enc adj errs: 0 fallbacks: 0
no Replace: 0 num seq errs: 0 num desc errs: 0 cmds complete: 844151
Bad reqs: 0 Dead cnxts: 0 No Paks: 0 enq errs: 0
rx pkt drops: 0 tx pkt drops: 0 dequeues: 0 requeues: 0
drops disabled: 0 clears: 0 ints: 844314 purges: 0
no cnxts: 0 bad algos: 0 no crams: 0 bad paks: 0
# opens: 0 # closes: 0 # hangs: 0
Related Commands
Command
Description
showcompress
Displays compression statistics.
show pas eswitch address
To display the Layer 2 learned addresses for an interface, use the showpaseswitchaddress command in user EXEC or privileged EXEC mode.
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
Examples
The following sample output shows that the first PA-12E/2FE interface (listed below as port 0) in port adapter slot 3 has learned the Layer 2 address 00e0.f7a4.5100 for bridge group 30 (listed below as BG 30):
Router# show pas eswitch address fastethernet 3/0
U 00e0.f7a4.5100, AgeTs 56273 s, BG 30 (vLAN 0), Port 0
show pas i82543 interface
To display interface information that is specific to Fast Ethernet or Gigabit Ethernet port adapters with an Intel 82543 processor on Cisco 7200 series routers, use the
showpasi82543interfacecommand in privileged EXEC mode.
This command was introduced on Cisco 7200 series routers.
12.1(20)E
This command was integrated into Cisco IOS Release 12.1(20)E on Cisco 7200 series routers.
12.0(27)S
This command was integrated into Cisco IOS Release 12.0(27)S on Cisco 7200 series routers.
12.3(7)T
This command was integrated into Cisco IOS Release 12.3(7)T on Cisco 7200 series routers.
Usage Guidelines
Use the
showpasi82543interface command with the
statistics keyword to determine what types of packets are being processed. Similar statistical information is displayed by the
showcontrollersfastethernet and
showcontrollersgigabitethernet commands.
Note
We recommend that the
multicast-table and
receive-address keywords for this command be used only under the supervision of a Cisco engineer because of the cryptic output.
Examples
The following sample output shows the contents of the multicast address table present on the i82543 processor.
The table below describes significant fields shown in the display.
Table 17
showpasi82543interfacestatistics Field Descriptions
Field
Description
CRC error
Cyclic redundancy checksum (CRC) generated by the originating LAN station or far-end device does not match the checksum calculated from the data received. On a LAN, this usually indicates noise or transmission problems on the LAN interface or the LAN bus itself. A high number of CRCs is usually the result of collisions or a station transmitting bad data.
Symbol error
Number of symbol errors between reads.
Missed Packets
Indicates whether the software processes that handle the line protocol believe that the interface is usable (that is, whether keepalives are successful) or if it has been taken down by an administrator.
Single Collision
Number of times that a transmit operation encountered a single collision.
Excessive Coll
This counter is incremented after a transmit operation has encountered more than 16 collisions.
Multiple Coll
Number of times that a transmit operation encountered more than 1 collision, but less than 16 collisions.
Late Coll
Number of late collisions. A late collision happens when a collision occurs after transmitting the preamble. The most common cause of late collisions is Ethernet cable segments that are too long for the speed at which you are transmitting.
Collision
Number of messages transmitted because of an Ethernet collision. A packet that collides is counted only once in output packets.
Defer
Defer indicates that the chip had to defer while ready to transmit a frame because the carrier was asserted.
Receive Length
Number of receive length error events. A receive length error occurs if an incoming packet passes the filter criteria but is either oversized or undersized. Packets less than 64 bytes are undersized. Packets over 1522 bytes are oversized if LongPacketEnable (LPE) is 0. If LPE is 1, a packet is considered oversized if it exceeds 16,384 bytes.
Sequence Error
Number of sequence error events.
XON RX
Number of XON packets received.
XON TX
Number of XON packets transmitted.
XOFF RX
Number of XOFF packets received.
XOFF TX
Number of XOFF packets transmitted.
FC RX Unsupport
Number of unsupported flow control frames received.
Packet RX
Number of received packets of the following lengths in bytes: 64, 127, 255, 511, 1023, 1522.
Good Packet RX
Number of received packets without errors.
Broadcast RX
Number of broadcast packets received.
Multicast RX
Number of multicast packets received.
Good Packet TX
Number of transmitted packets without errors.
Good Octets
Number of good (without errors) octets received (RX) or transmitted (TX).
RX No Buff
Number of times that frames were received when there were no available buffers in host memory to store those frames. The packet will be received if there is space in FIFO memory.
RX Undersize
Number of received frames that passed through address filtering and were less than the minimum size of 64 bytes (from destination address through CRC, inclusively), but that contained a valid CRC.
RX Fragment
Number of received frames that passed through address filtering and were less than the minimum size of 64 bytes (from destination address through CRC, inclusively), but that contained a bad CRC.
RX Oversize
Number of received frames that passed through address filtering and were greater than the maximum size.
RX Octets
Total number of octets received.
TX Octets
Total number of octets transmitted.
TX Packet
Number of transmitted packets.
RX Packet
Number of received packets.
TX Broadcast
Number of broadcast packets transmitted.
TX Multicast
Number of multicast packets transmitted.
Packet TX
Number of transmitted packets of the following lengths in bytes: 64, 127, 255, 511, 1023, 1522.
TX Underruns
Number of times that the transmitter has been running faster than the router can handle. This may never be reported on some interfaces.
TX No CRS
Number of successful packet transmissions in which Carrier Sense (CRS) input from the physical layer was not asserted within one slot time of start of transmission.
RX Error Count
Number of receive packets in which RX_ER was asserted by the physical layer.
RX DMA Underruns
Number of receive direct memory access (DMA) underruns observed by the DMA.
RX Carrier Ext
Number of packets received in which the carrier extension error was signalled across the gigabit medium independent interface (GMII) interface.
TCP Segmentation
Number of TCP segmentation offload transmissions to the hardware.
TCP Seg Failed
Number of TCP segmentation offload transmissions to the hardware that failed to transmit all data in the TCP segmentation context payloads.
Related Commands
Commands
Description
showcompress
Displays compression statistics.
showcontrollersfastethernet
Displays information about Fast Ethernet controllers.
showcontrollersgigabitethernet
Displays information about Gigabit Ethernet controllers.
showinterfaces
Displays information about interfaces.
show pas isa controller
To show controller information that is specific to the Virtual Private Network (VPN) accelerator controller when an Integrated Services Adapter (ISA) is installed, use the showpasisacontrollerEXEC command.
showpasisacontroller
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.1(5)T
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
Examples
The following is sample output from the showpasisacontroller command:
Router# show pas isa controller
Interface ISA5/1 :
Encryption Mode = IPSec
Addresses of Rings and instance structure:
High Priority Rings
TX: 0x4B0E97C0 TX Shadow:0x62060E00
RX: 0x4B0EB840 RX Pool:0x4B0EBC80 RX Pool Shadow:0x62068E58
Low Priority Rings
TX: 0x4B0EA800 TX Shadow:0x62066E2C
RX: 0x4B0EC0C0, RX Shadow:0x62069284
Instance Structure address:0x620603D8
Firmware write head/tail offset:0x4B0EC900
Firmware read head/tail offset:0x3EA00000
Related Commands
Command
Description
showpasisainterface
Displays interface status information that is specific to the VPN accelerator card.
show pas isa interface
To display interface information that is specific to the Virtual Private Network (VPN) accelerator card when an Integrated Services Adapter (ISA) is installed, use the
showpasisainterfacecommand in privileged EXEC mode.
showpasisainterface
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.1(5)T
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
Examples
The following is sample output from the
showpasisainterface command:
Router# show pas isa interface
Interface ISA5/1 :
Statistics of packets and bytes through this interface:
2876894 packets in 2910021 packets out
420 paks/sec in 415 paks/sec out
2327 Kbits/sec in 2408 Kbits/sec out
632 commands out 632 commands acknowledged
low_pri_pkts_sent 1911 low_pri_pkts_rcvd: 1911
invalid_sa: 260 invalid_flow: 33127
invalid_dh: 0 ah_seq_failure: 0
ah_spi_failure: 0 esp_auth_failure: 0
esp_seq_failure: 0 esp_spi_failure: 0
esp_protocol_absent: 0 ah_protocol_absent: 0
bad_key_group: 0 no_shared_secret: 0
no_skeyids: 0 pad_size_error: 0
cmd_ring_full: 0 bulk_ring_full: 990
bad_peer_pub_len: 0 authentication_failure: 0
fallback: 1606642 no_particle: 0
6922 seconds since last clear of counters
The table below describes the significant fields shown in the display.
Table 18 show pas isa interface Field Descriptions
Field
Description
packets in/out
Number of data packets received from, or sent to, the Integrated Service Adapter (ISA).
paks/sec in/out
Number of packets received in, or sent out, with the total number of seconds that the ISA is active.
Kbits/sec in/out
Number of kilobits (Kbits) received in, or sent out, with the total number of seconds that the ISA is active.
commands out
Number of commands going to the ISA. Examples of commands include setting up encryption sessions and retrieving statistics or status from the ISA.
commands acknowledged
Number of commands returning from the ISA. Examples of commands include setting up encryption sessions and retrieving statistics or status from the ISA.
low_pri_pkts_sent
This is a summary counter for number of Internet Key Exchange (IKE) and IPSec commands submitted to ISA.
low_pri_pkts_rcvd
This is a summary counter for number of IKE & IPSEC command responses received from ISA.
invalid_sa
Reference to an unusable security association key pair.
invalid_flow
An invalid packet using an IPSec key is received for encryption or decryption.
Example: session has expired.
invalid_dh
Reference to an unusable Diffie-Hellman( DH) key pair.
ah_seq_failure
Unacceptably late Authentication Header (AH) header received.
ah_spi_failure
SPI specified in the AH header does not match the SPI associated with the IPSec AH key.
esp_auth_failure
Number of ESP packets received with authentication failures.
esp_seq_failure
Unacceptably late ESP packet received.
esp_spi_failure
SPI specified in the ESP header does not match the SPI associated with the IPSec ESP key.
esp_protocol_absent
Packet is missing expected ESP header.
ah_protocol_absent
Packet is missing expected AH header.
bad_key_group
Unsupported key group requested during a Diffie-Hellman generation.
no_shared_secret
Attempting to use a Diffie-Hellman shared secret that is not generated.
no_skeyids
Attempting to use a shared secret that is not generated.
pad_size_error
The length of the ESP padding is greater than the length of the entire packet.
cmd_ring_full
New IKE setup messages are not queued for processing until the previous queued requests are processed.
bulk_ring_full
New packets requiring IPSec functionality are not queued to the ISA until the ISA completes the processing of existing requests.
bad_peer_pub_len
Length of peer's DH public key does not match the length specified for the negotiated DH key group.
authentication_failure
Authentication failed.
fallback
The number of instances when the driver is successful in getting a replacement buffer from the global pool.
no_particle
The number of instances when the driver was unable to get a replacement buffer from the driver pool and the global (fallback) pool.
Related Commands
Command
Description
showpasisacontroller
Displays controller status information that is specific to the VPN accelerator card.
show pas vam controller
To display controller information that is specific to the VPN Acceleration Module (VAM), use the showpasvamcontroller command in privileged EXEC mode.
showpasvamcontroller
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.1(9)E
This command was introduced.
12.2(9)YE
This command was integrated into Cisco IOS Release 12.2(9)YE.
12.2(13)T
This command was integrated into Cisco IOS Release 12.2(13)T.
Examples
The following is sample output from theshowpasvamcontrollercommand:
Displays interface status information specific to the VPN accelerator module.
show pas vam interface
To display interface information that is specific to the VPN Acceleration Module (VAM), use the
showpasvaminterface command in privileged EXEC mode.
showpasvaminterface
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.1(9)E
This command was introduced.
12.2(9)YE
This command was integrated into Cisco IOS Release 12.2(9)YE.
12.2(13)T
This command was integrated into Cisco IOS Release 12.2(13)T.
Usage Guidelines
Enter theshowpasvaminterface command to see if the VAM is currently processing crypto packets.
Examples
The following is sample output from the
showpasvaminterface command:
Router# show pas vam interface
Interface VAM 2/1 :
ds: 0x621CE0D8 idb:0x621C28DC
Statistics of packets and bytes that through this interface:
1110 packets in 1110 packets out
123387 bytes in 100979 bytes out
0 paks/sec in 0 paks/sec out
0 Kbits/sec in 0 Kbits/sec out
3507 commands out 3507 commands acknowledged
ppq_full_err : 0 ppq_rx_err : 0
cmdq_full_err : 0 cmdq_rx_err : 0
no_buffer : 0 fallback : 0
dst_overflow : 0 nr_overflow : 0
sess_expired : 0 pkt_fragmented : 0
out_of_mem : 0 access_denied : 0
invalid_fc : 0 invalid_param : 0
invalid_handle : 0 output_overrun : 0
input_underrun : 0 input_overrun : 0
key_invalid : 0 packet_invalid : 0
decrypt_failed : 0 verify_failed : 0
attr_invalid : 0 attr_val_invalid : 0
attr_missing : 0 obj_not_wrap : 0
bad_imp_hash : 0 cant_fragment : 0
out_of_handles : 0 compr_cancelled : 0
rng_st_fail : 0 other_errors : 0
3420 seconds since last clear of counters
The table below describes the significant fields shown in the display.
Table 19 show pas vam interface Field Descriptions
Field
Description
packets in/out
Number of data packets received from, or sent to, the VAM.
bytes in/out
Number of data bytes received from, or sent to, the VAM.
paks/sec in/out
Number of packets received in, or sent out, with the total number of seconds that the VAM is active.
Kbits/sec in/out
Number of kilobits (Kbits) received in, or sent out, with the total number of seconds that the VAM is active.
commands out
Number of commands going to the VAM. Examples of commands include setting up encryption sessions and retrieving statistics or status from the VAM.
commands acknowledged
Number of commands returning from the VAM. Examples of commands include setting up encryption sessions and retrieving statistics or status from the VAM.
ppq_full_err
Number of packets dropped because of a lack of space in the packet processing queues for the VAM. This usually means that input traffic has reached VAM maximum throughput possible.
ppq_rx_err
Summary counter for all errors related to packet processing.
cmdq_full_err
Number of commands dropped because of a lack of space in the command processing queues for the VAM. This error indicates that the input tunnel setup rate has reached the VAM maximum setup rate. The Internet Key Exchange (IKE) process retries the tunnel creation and deletion when commands are dropped by VAM.
cmdq_rx_err
Summary counter for all errors related to command processing (for example, IKE, or IPSec session creation or deletion).
no_buffer
Errors related to the VAM running out of buffers. May occur with large packets. Although VAM buffers cannot be tuned, try tuning buffers for other interfaces.
fallback
Internal VAM buffer pool is completely used up and VAM has to fallback to global buffer pool. This may cause minor performance impact, however, packets are still processed so this error can be ignored.
dst_overflow
Counter that is incremented when the VAM has completed an operation, but there is no available space into which to place the result.
nr_overflow
Counter that is incremented when the VAM has completed an operation, but there is no available space into which to place the result.
sess_expired
Counter that is incremented if the session used to encrypt or decrypt the packet has expired because of time or space limit.
pkt_fragmented
Counter that is incremented when the input packet has to be fragmented after encryption. This counter should always be 0 as fragmentation by VAM is disabled.
out_of_mem
Counter that is incremented when the VAM runs out of memory.
access_denied
Counter that is incremented when the VAM is requested to perform an operation on an object that can not be modified.
invalid_fc
Counter that is incremented when the VAM has received a request that is illegal for the specified object type.
invalid_param
Counter that is incremented when the VAM has received invalid parameters within a command.
invalid_handle
Counter that is incremented when the VAM receives a request for an operation to be performed on an object that does not exist.
output_overrun
Counter that is incremented when the space allocated for a response is not large enough to hold the result posted by the VAM.
input_underrun
Counter that is incremented when the VAM receives a packet for which it finds a premature end to the data, for example, a truncated packet.
input_overrun
Counter that is incremented when the VAM receives a buffer that is too large for the requested operation.
key_invalid
Counter that is incremented when the VAM receives a request for an operation on a key where the key is invalid or of the wrong type.
packet_invalid
Counter that is incremented when the VAM receives a packet whose body is badly formed.
decrypt_failed
Counter that is incremented when the VAM receives a packet that cannot be decrypted because the decrypted data was not properly formatted (for example, padding is wrong).
verify_failed
Counter that is incremented when the VAM receives a packet which could not be verified because the verification of a signature or authentication value failed.
attr_invalid
Counter that is incremented when the VAM receives a packet which specifies an attribute that is not correct for the specified object or operation.
attr_val_invalid
Counter that is incremented when the VAM encounters errors during packet or command processing. The packets or commands are dropped in such cases.
attr_missing
Counter that is incremented when the VAM receives an operation request for which the value of a required attribute is missing.
obj_not_wrap
Counter that is incremented when the VAM receives an operation request to retrieve an object that is hidden or unavailable for export beyond the FIPS boundary of the VPN Module.
bad_imp_hash
Counter that is incremented when the VAM sees a hash miscompare on unwrap.
cant_fragment
Counter that is incremented when the VAM determines a need to fragment a packet, but cannot fragment because the “don’t fragment” bit is set. This counter should always be zero because the fragmentation on the VAM is disabled.
out_of_handles
Counter that is incremented when the VAM has run out of available space for objects of the requested type.
comp_cancelled
Due to the operation of the compression algorithm, some data patterns cannot be compressed. Usually data that has already been compressed or data that does not have a sufficient number of repetitive patterns cannot be compressed and a compress operation would actually result in expansion of the data.
There are certain known data patterns which do not compress. In these cases, the compression engine cancels the compression of the data and returns the original, uncompressed data without an IPPCP header.
These counters are useful to determine if the content of the traffic on the network is actually benefiting from compression. If a large percentage of the network traffic is already compressed files, these counters may indicate that compression on these streams are not improving the performance of the network.
rng_st_fail
Counter that is incremented when the VAM detects a Random Number Generator self test failure.
pkt_replay_err
Counter that is incremented when a replay error is detected by the VAM.
other_errors
Counter that is incremented when the VAM encounters a packet or command error that is not listed in other error categories. An example could be if the packet IP header checksum is incorrect.
Related Commands
Command
Description
showpasvamcontroller
Displays controller status information that is specific to the VPN accelerator module.
show pas y88e8k interface
To display the y88e8k Port Adaptor Information (pas) message details of a Gigabit Ethernet interface, use the showpasy88e8kinterface command in User EXEC or privileged EXEC mode.
Table 1
describes the significant fields shown in the display.
Table 20 show pas y88e8k interface Field Descriptions
Field
Description
ring size
Displays the size of the ring. This is based on the bandwidth of the interface or virtual circuit (VC) and is a power of two.
particle size
Displays the particle size on the receive and transmit paths, in bytes.
ring head
Displays the head of the ring.
tail
Displays the tail of the ring.
rxr
Displays the Rx ring pointer.
next_desc_addr
Displays next Rx buffer descriptor address.
buf_ctrl
Displays the buffer control.
buf_addr_lo
Displays the buffer address.
frame_sw
Displays the Frame status word.
rxr_shadow
Displays the Rx ring shadow.
data_start
Displays the start of data in the particle.
data_bytes
Displays the number of bytes consumed for data storage.
Related Commands
Command
Description
tx-ring-limit
Limits the number of packets that can be used on a transmission ring on the DSL WIC or interface.
show pci aim
To show the IDPROM contents for each compression Advanced Interface Module (AIM) daughter card in the Cisco 2600 router, use the showpciaimcommand in user EXEC or privileged EXEC mode.
showpciaim
Syntax Description
This command has no arguments or keywords.
Command Modes
User EXEC
Privileged EXEC
Command History
Release
Modification
12.0(1)T
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2SX
This command is supported in the Cisco IOS Release 12.2SX train. Support in a specific 12.2SX release of this train depends on your feature set, platform, and platform hardware.
Usage Guidelines
This command shows the IDPROM contents for each compression AIM daughtercard present in the system, by AIM slot number (currently 0, since that is the only daughtercard installed for Cisco IOS Release 12.0(1)T). The IDPROM is a small PROM built into the AIM board used to identify it to the system. It is sometimes referred to as an EEPROM because it is implemented using electronically erasable PROM.
Examples
The following example shows the IDPROM output for the installed compression AIM daughter card:
Support for this command was introduced on the Supervisor Engine 720.
12.2(17d)SXB
Support for this command on the Supervisor Engine 2 was extended to Cisco IOS Release 12.2(17d)SXB. This command was changed to include the
hardwarepfcmodekeywords.
12.2(18)SXD
This command was modified to include the software ipv6-multicast connectedkeywords.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(33)SRC
This command was modified to include additional keywords to support CoPP enhancements on the Cisco 7600 SIP-400 on the Cisco 7600 series router.
Cisco IOS XE Release 2.1
This command was integrated into Cisco IOS XE Release 2.1.
12.2(33)SRD
This command was modified. The
atomether-vc keyword was added.
Cisco IOS XE Release 3.9S
This command was integrated into Cisco IOS XE Release 3.9S.
Usage Guidelines
This command is similar to the
showmsfc command.
This command can be used to verify the existence of a second Cisco IOS process on a single Cisco ASR 1000 RP on a Cisco ASR 1002 router or Cisco ASR 1004 router.
When this command is used with the
atomether-vc keyword, it is used on the line-card console.
Examples
The following sample output from the
showplatformbuffers command displays buffer-allocation information:
Router# show platform buffers
Reg. set Min Max
TX 640
ABQ 640 16384
0 0 40
1 6715 8192
2 0 0
3 0 0
4 0 0
5 0 0
6 0 0
7 0 0
Threshold = 8192
Vlan Sel Min Max Cnt Rsvd
1019 1 6715 8192 0 0
Router#
Examples
The following example displays online status information for the Cisco ISR 4400 Front Panel Gigabit Ethernet port (ISR4451-4X1GE), Cisco SSD Carrier Card Network Interface Module (NIM-SSD), Cisco SM-1T3/E3 Service Module (SM-1T3/E3), and Cisco 4th Generation T1/E1 Voice and WAN Network Interface Module (NIM 8MFT-T1/E1)
Router# show platform
Chassis type: ISR4452/K9
Slot Type State Insert time (ago)
--------- ------------------- --------------------- -----------------
0 ISR4452/K9 ok 15:57:33
0/0 ISR4451-4X1GE ok 15:55:24
0/3 NIM-SSD ok 15:55:24
1 ISR4452/K9 ok 15:57:33
1/0 NIM 8MFT-T1/E1 ok 15:55:24
2 ISR4452/K9 ok 15:57:33
2/0 SM-1T3/E3 ok 15:55:24
R0 ISR4452/K9 ok, active 15:57:33
F0 ISR4451-FP ok, active 15:57:33
P0 Unknown ps, fail never
P1 XXX-XXXX-XX ok 15:56:58
P2 ACS-4450-ASSY ok 15:56:58
Slot CPLD Version Firmware Version
--------- ------------------- ---------------------------------------
0 12090323 15.3(01r)S [ciscouser-ISRRO...
1 12090323 15.3(01r)S [ciscouser-ISRRO...
2 12090323 15.3(01r)S [ciscouser-ISRRO...
R0 12090323 15.3(01r)S [ciscouser-ISRRO...
F0 12090323 15.3(01r)S [ciscouser-ISRRO...
The table below describes the fields that appear in the above example
Table 21 Show Platform Field Descriptions
Field
Descriptions
Slot
slot number
Type
Type of module
State
Status of the module
Insert Time
Period of time ((hh:mm:ss format) since the module has been up and running
The following example displays online status information for the shared port adapters (SPAs), Cisco ASR 1000 SPA Interface Processor (SIP), Cisco ASR 1000 Embedded Services Processor (ESP), Cisco ASR 1000 RP, power supplies, and fans. The ESPs are shown as F0 and F1. The RPs are shown as R0 and R1.
The State column should display “ok” for SIPs, SPAs, power supplies, and fans. For RPs and ESPs, the State column should display “ok, active” or “ok, standby.”
Router# show platform
Chassis type: ASR1006
Slot Type State Insert time (ago)
--------- ------------------- --------------------- -----------------
0 ASR1000-SIP10 ok 18:23:58
0/0 SPA-5X1GE-V2 ok 18:22:38
0/1 SPA-8X1FE-TX-V2 ok 18:22:33
0/2 SPA-2XCT3/DS0 ok 18:22:38
1 ASR1000-SIP10 ok 18:23:58
1/0 SPA-2XOC3-POS ok 18:22:38
1/1 SPA-8XCHT1/E1 ok 18:22:38
1/2 SPA-2XT3/E3 ok 18:22:38
R0 ASR1000-RP1 ok, active 18:23:58
R1 ASR1000-RP1 ok, standby 18:23:58
F0 ASR1000-ESP10 ok, active 18:23:58
F1 ASR1000-ESP10 ok, standby 18:23:58
P0 ASR1006-PWR-AC ok 18:23:09
P1 ASR1006-FAN ok 18:23:09
Slot CPLD Version Firmware Version
--------- ------------------- ---------------------------------------
0 06120701 12.2(33r)XN2
1 06120701 12.2(33r)XN2
R0 07082312 12.2(33r)XN2
R1 07082312 12.2(33r)XN2
F0 07051680 12.2(33r)XN2
F1 07051680 12.2(33r)XN2
Examples
In the following example, a second Cisco IOS process is enabled on a Cisco ASR 1004 router using stateful switchover (SSO). The output of the
showplatform command is provided before and after the SSO configuration to verify that the second Cisco IOS process is enabled and active.
Router# show platform
Chassis type: ASR1004
Slot Type State Insert time (ago)
--------- ------------------- --------------------- -----------------
0 ASR1000-SIP10 ok 00:04:39
0/0 SPA-5X1GE-V2 ok 00:03:23
0/1 SPA-2XT3/E3 ok 00:03:18
R0 ASR1000-RP1 ok, active 00:04:39
F0 ASR1000-ESP10 ok, active 00:04:39
P0 ASR1004-PWR-AC ok 00:03:52
P1 ASR1004-PWR-AC ok 00:03:52
Slot CPLD Version Firmware Version
--------- ------------------- ---------------------------------------
0 07091401 12.2(33r)XN2
R0 07062111 12.2(33r)XN2
F0 07051680 12.2(33r)XN2
Router# configure terminal
Enter configuration commands, one per line. End with CNTL/Z.
Router(config)# redundancy
Router(config-red)# mode sso
*May 27 19:43:43.539: %CMRP-6-DUAL_IOS_REBOOT_REQUIRED: R0/0: cmand: Configuration must be saved and the chassis must be rebooted for IOS redundancy changes to take effect
Router(config-red)# exit
Router(config)# exit
Router#
*May 27 19:44:04.173: %SYS-5-CONFIG_I: Configured from console by user on console
Router# copy running-config startup-config
Destination filename [startup-config]?
Building configuration...
[OK]
Router# reload
Proceed with reload? [confirm]
*May 27 19:45:16.917: %SYS-5-RELOAD: Reload requested by user on console. Reload Reason: Reload command.
<reload output omitted for brevity>
Router# show platform
Chassis type: ASR1004
Slot Type State Insert time (ago)
--------- ------------------- --------------------- -----------------
0 ASR1000-SIP10 ok 00:29:34
0/0 SPA-5X1GE-V2 ok 00:28:13
0/1 SPA-2XT3/E3 ok 00:28:18
R0 ASR1000-RP1 ok 00:29:34 R0/0ok,active00:29:34R0/1ok,standby00:27:49F0 ASR1000-ESP10 ok, active 00:29:34
P0 ASR1004-PWR-AC ok 00:28:47
P1 ASR1004-PWR-AC ok 00:28:47
Slot CPLD Version Firmware Version
--------- ------------------- ---------------------------------------
0 07091401 12.2(33r)XN2
R0 07062111 12.2(33r)XN2
F0 07051680 12.2(33r)XN2
The table below describes the significant fields shown in the display.
Table 22 show platform Field Descriptions
Field
Description
Slot
Chassis slot.
Type
Hardware type.
State
Online state of the hardware. One of the following values:
All Hardware
booting--Hardware is initializing and software is booting.
disabled--Hardware is not operational.
init--Hardware or Cisco IOS process is initializing.
ok--Hardware is operational.
shutdown--Hardware was administratively shut down using the no shutdown command.
unknown--Hardware is not operational; state is unknown.
RP or ESP
init, standby--Standby RP or ESP is operational but is not yet in a high availability (HA) state. An RP or ESP switchover is not yet possible.
ok, active--Active RP or ESP is operational.
ok, standby--Standby RP or ESP is operational. The standby RP or ESP is ready to become active in the event of a switchover.
SPA
admin down--SPA was disabled using the shutdown command.
inserted--SPA is being inserted.
missing--SPA was removed.
out of service--SPA is not operational.
retrieval error--An error occurred while retrieving the SPA state; state is unknown.
stopped--SPA was gracefully deactivated using the hw-module subslot stop command.
Fan or Power Supply
fan, fail--Fan is failing.
ps, fail--Power supply is failing.
Insert time (ago)
Amount of time (hh:mm:ss format) the hardware has been online.
CPLD Version
Complex programmable logic device version number.
Firmware Version
Firmware (ROMmon) version number.
Examples
The following sample output from the
showplatformcopprate-limitarp command displays the list of interfaces on which a rate limiter is active for ARP, along with the count of confirmed and exceeded packets for the rate limiter:
Router# show platform copp rate-limit arp
Rate limiter Information for Protocol arp:
Rate Limiter Status: Enabled
Rate : 20 pps
Max Observation Period : 60 seconds
Per Interface Rate Limiter Information
Interface Conformed Pkts Exceeded Pkts Enabled Obs Period (Mts)
GigabitEthernet5/1 0 0 No -
GigabitEhternet5/1.1 14 0 No -
GigabitEthernet5/1.2 28 2 No -
GigabitEthernet5/2 0 0 No -
GigabitEthernet5/2.1 180 4 Yes 35
GigabitEthernet5/2.2 200 16 Yes Max
The table below describes the significant fields shown in the display.
Table 23 show platform copp rate-limit Field Descriptions
Field
Description
Rate Limiter Status
Indicates if a rate limiter has been enabled on the interface.
Rate
Indicates the configured rate in packets per second (pps) or bits per second (bps).
Max Observation Period
Indicates the configured observation period, in seconds, before the per-interface rate limiter is automatically turned off.
Per Interface Rate Limiter Information
Displays the list of interfaces on which the rate limiter is active. In this example:
GigabitEthernet5/1.1 is free from attack.
GigabitEthernet5/2.1 has an exceed count of 4, and has a rate limiter enabled. The observation period is 35 minutes, which indicates that currently the interface is free from attack and is being kept under observation. The interface will remain under observation for an additional 35 minutes. If it remains free from attack after that time, the rate limiter is automatically removed.
GigabitEthernet5/2.2 has an exceed count of 16 and has a rate limiter enabled. The observation period has been designated as Max. This indicates that the interface is still under attack and has not yet entered the observation time window.
The following sample from the
showplatformeeprom command displays CPU EEPROM information:
Turns on or off rate-limiting for an interface on the Cisco 7600 SIP-400.
platformcoppobservationperiod
Sets the observation period before automatically turning off the per-interface rate limiter on the Cisco 7600 SIP-400.
pseudowireclass
Specifies the name of a Layer 2 pseudowire class.
showmsfc
Displays MSFC information.
show platform acl software-switched
To display whether ACLs are enabled for software-switched WAN packets, use the showplatformaclsoftware-switchedcommand in privileged EXEC mode.
showplatformaclsoftware-switched
Syntax Description
This command has no arguments or keywords.
Command Default
This command has no default settings.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(50)SY
This command was introduced.
12.2(33)SXI2
This command was integrated into Cisco IOS Release 12.2(33)SXI2.
Usage Guidelines
By default, ACLs are not applied to packets that are software-switched between WAN cards and the route processor. To determine whether ACLs are enabled for software-switched ingress or egress WAN packets, use the showplatformaclsoftware-switchedcommand.
Examples
This example shows how to display whether ACLs are enabled for software-switched WAN packets:
Router# show platform acl software-switched
CWAN: ACL treatment for software switched in INGRESS is enabled
CWAN: ACL treatment for software switched in EGRESS is disabled
Related Commands
Command
Description
platformcwanaclsoftware-switched
Allows ACLs to be applied to WAN packets that are software-switched.
show platform atom disp-tbl backup
To
display the disposition table on the line card for backup VCs, use the showplatformatomdisp-tblbackup command
in privileged EXEC mode
.
showplatformatomdisp-tblbackuppseudo-ckt-index
Syntax Description
pseudo-ckt-index
Defines the pseudo-circuit-index. The acceptable range is between 1 and 65537.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
The show platform atom disp-tbl backup command should be used while using the Hot-Standby Psuedo Wire (HSPW) feature.
Examples
The following example displays the disposition table on the Line Card for backup VCs.
Router# show platform atom disp-tbl backup
Pseudo Dlci or Local Outgoing IW Backup
Ckt Idx Vcd Label Interface Type VC
------- ------- ------- --------------------- ---- ------
32786 2 24 AC0 L2L Yes
Related Commands
Command
Description
showplatformatomdisp-tbllocal-vc-label
Displays the disposition table on the line card for a VC based on the local label.
showplatformatomtbl-summary
Displays the total number of PWs programmed on the Line Card.
showplatformatomimp-tblbackup
Displays the imposition table on the line card for backup VCs.
showplatformatomimp-tblremote-vc-label
Displays the imposition table on the line card for a VC based on the remote label.
show platform atom disp-tbl local-vc-label
To
display the disposition table on the line card for a VC based local label, use the showplatformatomdisp-tbllocal-vc-label command
in privileged EXEC mode
.
Defines the VC based local label. The acceptable range is between 15 and 1048575.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
The show platform atom disp-tbl local-vc-label command should be used only if you know the Local VC Label for a VC.
Examples
The following example displays the disposition table on the Line Card for a VC based on the local label.
Router# show platform atom imp-tbl remote-vc-label 97
Pseudo Ckt Idx Dlci or Vcd Dest Vlanid LTL Index # Lbls Imposed Remote Label
-------------- ------------- ------------ ---------- --------------- --------------
49170 2 1028 0xFF 2 97
Local Label Outgoing Interface IW Type Backup VC AC segment ssm id Segment Status
----------- -------------------- ------- --------- ------------------- --------------
57 Gi4/3/3 L2L No 20561 UP
Related Commands
Command
Description
showplatformatomimp-tblremote-vc-label
Displays the imposition table on the line card for a VC based on the remote label.
showplatformatomtbl-summary
Displays the total number of PWs programmed on the line card.
showplatformatomimp-tblbackup
Displays the imposition table on the line card for backup VCs.
showplatformatomdisp-tblbackup
Displays the disposition table on the line card for backup VCs.
show platform atom imp-tbl backup
To
display the imposition table on the line card for backup VCs, use the showplatformatomimp-tblbackup command
in privileged EXEC mode
.
showplatformatomimp-tblbackuppseudo-ckt-index
Syntax Description
pseudo-ckt-index
Defines the pseudocircuitindex. The acceptable range is between 1 and 65537.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
The show platform atom imp-tbl backup command should be used while using the Hot-Standby Psuedo Wire (HSPW) feature.
Examples
The following example displays the imposition table on the Line Card for backup VCs.
Router# show platform atom imp-tbl backup
Pseudo Ckt Idx Dlci or Vcd Dest Vlanid LTL Index # Lbls Imposed Remote Label
-------------- ------------- ------------ ---------- --------------- --------------
432786 2 1029 0xFF 1 25
Local Label Outgoing Interface IW Type Backup VC AC segment ssm id Segment Status
----------- -------------------- ------- --------- ------------------- --------------
61 Gi4/0/1 L2L Yes 16464 STANDBY
Related Commands
Command
Description
showplatformatomdisp-tbllocal-vc-label
Displays the disposition table on the line card for a VC based on the local label.
showplatformatomtbl-summary
Displays the total number of PWs programmed on the Line Card.
showplatformatomdisp-tblbackup
Displays the disposition table on the line card for backup VCs.
showplatformatomimp-tblremote-vc-label
Displays the imposition table on the line card for a VC based on the remote label.
show platform atom imp-tbl remote-vc-label
To
display the imposition table on the line card for a VC based remote label, use the showplatformatomimp-tblremote-vc-label command
in privileged EXEC mode
.
Defines the remote VC based label. The acceptable range is between 15 and 1048575.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
The showplatformatomimp-tblremote-vc-label command should be used only if the Remote VC Label for a VC is known.
Examples
The following example displays the imposition table on the Line Card for a VC based on the remote label.
Router# show platform atom imp-tbl remote-vc-label 97
Pseudo Ckt Idx Dlci or Vcd Dest Vlanid LTL Index # Lbls Imposed Remote Label
-------------- ------------- ------------ ---------- --------------- --------------
49170 2 1028 0xFF 2 97
Local Label Outgoing Interface IW Type Backup VC AC segment ssm id Segment Status
----------- -------------------- ------- --------- ------------------- --------------
57 Gi4/3/3 L2L No 20561 UP
Related Commands
Command
Description
showplatformatomdisp-tbllocal-vc-label
Displays the disposition table on the line card for a VC based on the local label.
showplatformatomtbl-summary
Displays the total number of PWs programmed on the Line Card.
showplatformatomimp-tblbackup
Displays the imposition table on the line card for backup VCs.
showplatformatomdisp-tblbackup
Displays the disposition table on the line card for backup VCs.
show platform atom tbl-summary
To
display the total number of pseudowires (PWs) programmed on the line card., use theshowplatformatomtbl-summary command
in privileged EXEC mode
.
showplatformatomtbl-summary
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.1(1)S
This command was introduced.
Usage Guidelines
The showplatformatomtbl-summary command is used to determine the primaryPWs and backup PWs that are programmed.
Examples
This example displays the total number of PWs programmed on the Line Card.
Router# show platform atom tbl-summary
Total Number of entries(CWAN): 2, AToM Entries(LC): 2 Local Switching Entries(LC): 0
AToM Entries Primary: 1, Backup: 1
Related Commands
Command
Description
showplatformatomimp-tbllocal-vc-label
Displays the imposition table on the line card for a VC based on the remote label.
showplatformatomdisp-tbllocal-vc-label
Displays the disposition table on the line card for a VC based on the local label.
showplatformatomimp-tblbackup
Displays the imposition table on the line card for backup VCs.
showplatformatomdisp-tblbackup
Displays the disposition table on the line card for backup VCs.
show platform diag
To display diagnostic and debug information about individual platform components, use the
showplatformdiag command in privileged EXEC mode.
showplatformdiag
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 2.2
This command was introduced on the Cisco ASR 1000 Series Aggregation Services Routers.
Cisco IOS XE Release 3.9S
This command was integrated into Cisco IOS XE Release 3.9S.
Usage Guidelines
This command can be used to display the debug and diagnostic information about the Cisco ASR 1000 shared port adapter (SPA) Interface Processor (SIP), SPA, Cisco ASR 1000 Embedded Services Processor (ESP), Cisco ASR 1000 Route Processor (RP), and power supplies. This command also indicates the status of the field replaceable unit (FRU) components in any Cisco ASR 1000 Series Router.
Use the show platform diag command to display the debug and diagnostic information related to your Cisco 4400 Series Integrated Services Router (ISR), any connected Service Modules (SM-X) or Network Interface Modules (NIMs), power supply for front panel Gigabit Ethernet (FPGE) ports, Fan Trays and other components of your router.
Examples
The following is sample output from the show platform diag command. The Embedded Services Processor (ESP) is shown as F0 or F1. The RPs are shown as R0 or R1. The power supplies are shown as P0 and P1.
Device# show platform diag
Chassis type: ASR1004
Slot: 0, ASR1000-SIP10
Running state : ok
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:00:48 (4d22h ago)
Software declared up time : 00:01:40 (4d22h ago)
CPLD version : 07091401
Firmware version : 12.2(33r)XNB
Sub-slot: 0/0, SPA-5X1GE-V2
Operational status : ok
Internal state : inserted
Physical insert detect time : 00:00:36 (4d22h ago)
Logical insert detect time : 00:02:23 (4d22h ago)
Sub-slot: 0/1, SPA-2XT3/E3
Operational status : ok
Internal state : inserted
Physical insert detect time : 00:00:36 (4d22h ago)
Logical insert detect time : 00:02:23 (4d22h ago)
Slot: R0, ASR1000-RP1
Running state : ok
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:00:48 (4d22h ago)
Software declared up time : 00:00:48 (4d22h ago)
CPLD version : 07062111
Firmware version : 12.2(33r)XNB
Sub-slot: R0/0,
Running state : ok, active
Logical insert detect time : 00:00:48 (4d22h ago)
Became HA Active time : 00:04:56 (4d22h ago)
Sub-slot: R0/1,
Running state : ok, standby
Logical insert detect time : 00:02:50 (4d22h ago)
Slot: F0, ASR1000-ESP10
Running state : ok, active
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:00:48 (4d22h ago)
Software declared up time : 00:01:40 (4d22h ago)
Hardware ready signal time : 00:00:49 (4d22h ago)
Packet ready signal time : 00:01:49 (4d22h ago)
CPLD version : 07051680
Firmware version : 12.2(33r)XNB
Slot: P0, ASR1004-PWR-AC
State : ok
Physical insert detect time : 00:01:40 (4d22h ago)
Slot: P1, ASR1004-PWR-AC
State : ok
Physical insert detect time : 00:01:40 (4d22h ago)
Device# show platform diag
Chassis type: CSR1000V
Slot: R0, CSR1000V
Running state : ok, active
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:00:37 (00:02:26 ago)
Software declared up time : 00:00:37 (00:02:26 ago)
Slot: F0, CSR1000V
Running state : ok, active
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:00:37 (00:02:26 ago)
Software declared up time : 00:00:57 (00:02:06 ago)
Hardware ready signal time : 00:00:56 (00:02:06 ago)
Packet ready signal time : 00:01:01 (00:02:02 ago)
Examples
The following is a sample output from the show platform diag command.
Router# show platform diag
Chassis type: ISR4451/K9
Slot: 0, ISR4451/K9
Running state : ok
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:01:05 (6d23h ago)
Software declared up time : 00:01:46 (6d23h ago)
CPLD version : 12090323
Firmware version : 12.2(20120829:165313) [ciscouser-ESGROM_20120829_DELTA 101]
Sub-slot: 0/0, ISR4451-X-4x1GE
Operational status : ok
Internal state : inserted
Physical insert detect time : 00:02:57 (6d23h ago)
Logical insert detect time : 00:02:57 (6d23h ago)
Slot: 1, ISR4451/K9
Running state : ok
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:01:05 (6d23h ago)
Software declared up time : 00:01:47 (6d23h ago)
CPLD version : 12090323
Firmware version : 12.2(20120829:165313) [ciscouser-ESGROM_20120829_DELTA 101]
Sub-slot: 1/0, SM-X-1T3/E3
Operational status : ok
Internal state : inserted
Physical insert detect time : 00:02:57 (6d23h ago)
Logical insert detect time : 00:02:57 (6d23h ago)
Slot: 2, ISR4451/K9
Running state : ok
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:01:05 (6d23h ago)
Software declared up time : 00:01:48 (6d23h ago)
CPLD version : 12090323
Firmware version : 12.2(20120829:165313) [ciscouser-ESGROM_20120829_DELTA 101]
Slot: R0, ISR4451/K9
Running state : ok, active
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:01:05 (6d23h ago)
Software declared up time : 00:01:05 (6d23h ago)
CPLD version : 12090323
Firmware version : 12.2(20120829:165313) [ciscouser-ESGROM_20120829_DELTA 101]
Slot: F0, ISR4451/K9
Running state : ok, active
Internal state : online
Internal operational state : ok
Physical insert detect time : 00:01:05 (6d23h ago)
Software declared up time : 00:02:20 (6d23h ago)
Hardware ready signal time : 00:00:00 (never ago)
Packet ready signal time : 00:02:29 (6d23h ago)
CPLD version : 12090323
Firmware version : 12.2(20120829:165313) [ciscouser-ESGROM_20120829_DELTA 101]
Slot: P0, Unknown
State : ps, fail
Physical insert detect time : 00:00:00 (never ago)
Slot: P1, XXX-XXXX-XX
State : ok
Physical insert detect time : 00:01:30 (6d23h ago)
Slot: P2, ACS-4450-FANASSY
State : ok
Physical insert detect time : 00:01:30 (6d23h ago)
Slot: GE-POE, Unknown
State : NA
Physical insert detect time : 00:00:00 (never ago)
The table below describes the significant fields shown in the display.
Table 24 show platform diag Field Descriptions
Field
Description
Running state
The current online running state of the FRU component.
Internal state
The internal debug state of the FRU component for diagnostic purposes.
Internal operational state
The internal operational state of the FRU component for diagnostic purposes.
Physical insert detect time
The time of the most recent physical insertion of the FRU component detected by the platform code.
Software declared up time
The time that the software on the FRU component was declared running by the platform code.
Hardware ready signal time
The time that the hardware ready signal was detected by the platform code.
Packet ready signal time
The time that the ESP packet ready signal was detected by the platform code.
CPLD version
The Complex Programmable Logic Device (CPLD) version number.
Firmware version
The firmware ROM monitor (ROMMON) version number.
Logical insert detect time
The time that the SPA was logically detected by the platform code.
Became HA Active time
The time that this FRU became High Availability (HA) active.
Related Commands
Command
Description
showplatform
Displays platform information.
showplatformhardware
Displays platform hardware information.
showplatformsoftware
Displays platform software information.
show platform discover-devices
To display PCI device information, use the showplatformdiscover-devicescommand in privileged EXEC mode.
showplatformdiscover-devices
Syntax Description
showplatformdiscover-devices
Displays PCI device information.
Command Modes
Privileged EXEC mode
Command History
Release
Modification
15.1(1)T
This command was introduced for Cisco 3925E and Cisco 3945E Integrated Services Routers.
Usage Guidelines
Use the showplatformdiscover-devices command to display information about PCI devices on the router. The output shows the device name, interface slot and port, and detailed hardware information.
Examples
The following sample output shows PCI device information for Cisco 3925E ISR.
Table 25 Show Platform Discover-Devices Field Description
Field
Description
PCI Device
Identifies the PCI device on the router.
Root_port
Defines the root port address on the device.
Bus_no
Defines the bus number on the device.
Device_no
Defines the device number.
Func_no
Defines the function number.
Root_device_id
Defines the root device number.
DeviceID
Defines the device identifcation number.
VendorID
Defines the vendor identifcation number.
Operation Command
Defines the operation command.
Status of Device
Defines the status of device.
Class
Defines the class address.
Revision (type of device)
Defines type of device.
LatencyTimer
Defines the latency timer.
CacheLineSize
Defines cache line size.
Base Address
Address of Base.
Base Address 1
Address of Base 1.
Secondary Latency Timer
Defines secondary latency timer.
SubBus
Defines subordinate Bus number.
SecBus
Defines secondary Bus number.
PrimBus
Defines primary Bus number.
DeviceID
Defines the device identifcation number.
MemLimit
Defines the memory limit.
MemBase
Defines the memory base.
PrefMemLimit
Defines the pre-fetchable memory limit.
PrefMemBase
Defines the pre-fetchable memory base.
Related Commands
Command
Description
show platform cf
Shows CF support-related information.
show platform dma
Show DMA-related information.
show platform hw-module-power
Displays power settings of service modules.
show platform interrupt
Shows Interrupt-related information.
show platform io-controller
Displays IO-controller information.
show platform led
Shows LED-related information.
show platform nvram
Displays NVRAM-related information.
show platform versions
Displays versions/revisions of various modules.
show platform smbdev
Shows smbus slave devices.
show platform mgf
Shows multi-gigabit fabric information.
show platform dwdm alarm history
To display platform DWDM alarm history, use the
showplatformdwdmalarmhistorycommand in privileged EXEC mode.
showplatformdwdmalarmhistory
[ portindex ]
Syntax Description
portindex
Specifies the port index.
For a 7600-ES+ITU-2TG, the valid values for the port index are 1, 2.
For a 7600-ES+ITU-4TG, the valid values for the port index are 1, 2, 3, 4.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(33)SRD1
This command was introduced on the Cisco 7600 series routers for the 7600-ES+ITU-2TG and the 7600-ES+ITU-4TG line cards only.
Usage Guidelines
If the port index is not specified, the alarm history (last 32 alarms) for all ports on that line card whose interface transport mode is Optical Transport Network (OTN) is displayed. If a port index is specified, the alarm history (last 32 alarms) for that particular port is displayed, if the interface transport mode of that port is OTN. An alarm is logged in the alarm history only if the reporting for that alarm is enabled. If reporting for an alarm is disabled with the no g709 otu report command or the no g709 odu report command, then neither the alarm declaration nor clearing will be logged in the alarm history.
Examples
The following examples illustrate the command when interface TenGigabitEthernet 2/1 and interface TenGigabitEthernet 2/3 are configured with a transport-mode of OTN. Because the transport modes of interface TenGigabitEthernet 2/2 and interface TenGigabitEthernet 2/4 are not OTN, nothing is displayed for dwdm 2/2 and dwdm 2/4.
Router# show platform dwdm alarm history
dwdm 2/1 :
Current alarms in HW are
LOS
---- LAST 32 ALARMS ----------
00. LOS declared , *Jan 7 2009 21:16:40.165 UTC
dwdm 2/3 :
Current alarms in HW are
---- LAST 32 ALARMS ----------
00. LOS cleared , *Jan 7 2009 21:14:32.709 UTC
01. LOS declared , *Jan 7 2009 21:14:02.625 UTC
Router# show platform dwdm alarm history 1
dwdm 2/1 :
Current alarms in HW are
LOS
---- LAST 32 ALARMS ----------
00. LOS declared , *Jan 7 2009 21:16:40.165 UTC
Router# how platform dwdm alarm history 2
Router# show platform dwdm alarm history 3
dwdm 2/3 :
Current alarms in HW are
---- LAST 32 ALARMS ----------
00. LOS cleared , *Jan 7 2009 21:14:32.709 UTC
01. LOS declared , *Jan 7 2009 21:14:02.625 UTC
Related Commands
Command
Description
showcontrollersdwdm
Displays ITU-T G.709 alarms, alerts, and counters for a DWDM controller.
show platform hardware capacity
To display the capacities and utilizations for the hardware resources, use the
showplatformhardwarecapacitycommand in privileged EXEC mode.
showplatformhardwarecapacity [resource-type]
Syntax Description
resource-type
(Optional) Hardware resource type; see the “Usage Guidelines” section for the valid values.
Command Default
This command has no default settings.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(18)SXF
This command was introduced.
12.2(33)SRA
This command was integrated into Cisco IOS Release 12.2(33)SRA.
12.2(33)SXI
This command was integrated into Cisco IOS Release 12.2(33)SXI. Support was added for the
ibc and
rewrite-engine keywords.
Usage Guidelines
The valid values for
resource-type are as follows:
acl--Displays the capacities and utilizations for ACL/QoS TCAM resources.
cpu--Displays the capacities and utilizations for CPU resources.
eobc--Displays the capacities and utilizations for Ethernet out-of-band channel resources.
fabric--Displays the capacities and utilizations for Switch Fabric resources.
flash--Displays the capacities and utilizations for Flash/NVRAM resources.
forwarding--Displays the capacities and utilizations for Layer 2 and Layer 3 forwarding resources.
ibc--Displays the capacities and utilizations for interboard communication resources.
interface--Displays the capacities and utilizations for interface resources.
monitor--Displays the capacities and utilizations for SPAN resources.
multicast--Displays the capacities and utilizations for Layer 3 multicast resources.
netflow--Displays the capacities and utilizations for NetFlow resources.
pfc--Displays the capacities and utilizations for all the PFC resources including Layer 2 and Layer 3 forwarding, NetFlow, CPU rate limiters, and ACL/QoS TCAM resources.
power--Displays the capacities and utilizations for power resources.
qos--Displays the capacities and utilizations for QoS policer resources.
rate-limit--Displays the capacities and utilizations for CPU rate limiter resources.
rewrite-engine--Displays the packet drop and performance counters of the central rewrite engine on supervisors and line cards. For detailed information, see the
showplatformhardwarecapacityrewrite-enginecommand documentation.
system--Displays the capacities and utilizations for system resources.
vlan--Displays the capacities and utilizations for VLAN resources.
The
showplatformhardwarecapacitycpucommand displays the following information:
CPU utilization for the last 5 seconds (busy time and interrupt time), the percentage of the last 1-minute average busy time, and the percentage of the last 5-minute average busy time.
Processor memory total available bytes, used bytes, and percentage used.
I/O memory total available bytes, used bytes, and percentage used.
The
showplatformhardwarecapacityeobccommand displays the following information:
Transmit and receive rate
Packets received and packets sent
Dropped received packets and dropped transmitted packets
The
showplatformhardwarecapacityforwarding command displays the following information:
The total available entries, used entries, and used percentage for the MAC tables.
The total available entries, used entries, and used percentage for the FIB TCAM tables. The display is done per protocol base.
The total available entries, used entries, and used percentage for the adjacency tables. The display is done for each region in which the adjacency table is divided.
The created entries, failures, and resource usage percentage for the NetFlow TCAM and ICAM tables.
The total available entries and mask, used entries and mask, reserved entries and mask, and entries and mask used percentage for the ACL/QoS TCAM tables. The output displays the available, used, reserved, and used percentage of the labels. The output displays the resource of other hardware resources that are related to the ACL/QoS TCAMs (such as available, used, reserved, and used percentage of the LOU, ANDOR, and ORAND).
The available, used, reserved, and used percentage for the CPU rate limiters.
The
showplatformhardwarecapacityinterface command displays the following information:
Tx/Rx drops--Displays the sum of transmit and receive drop counters on each online module (aggregate for all ports) and provides the port number that has the highest drop count on the module.
Tx/Rx per port buffer size--Summarizes the port-buffer size on a per-module basis for modules where there is a consistent buffer size across the module.
The
showplatformhardwarecapacitymonitor command displays the following SPAN information:
The maximum local SPAN sessions, maximum RSPAN sessions, maximum ERSPAN sessions, and maximum service module sessions.
The local SPAN sessions used/available, RSPAN sessions used/available, ERSPAN sessions used/available, and service module sessions used/available.
The
showplatformhardwarecapacitymulticast command displays the following information:
Multicast Replication Mode: ingress and egress IPv4 and IPv6 modes.
The MET table usage that indicates the total used and the percentage used for each module in the system.
The bidirectional PIM DF table usage that indicates the total used and the percentage used.
The
showplatformhardwarecapacitysystemcommand displays the following information:
PFC operating mode (PFC Version: PFC3A, PFC3B, unknown, and so forth)
Supervisor redundancy mode (RPR, RPR+, SSO, none, and so forth)
Module-specific switching information, including the following information:
Part number (WS-SUP720-BASE, WS-X6548-RJ-45, and so forth)
Series (supervisor engine, fabric, CEF720, CEF256, dCEF256, or classic)
CEF Mode (central CEF, dCEF)
The
showplatformhardwarecapacityvlan command displays the following VLAN information:
Total VLANs
VTP VLANs that are used
External VLANs that are used
Internal VLANs that are used
Free VLANs
Examples
This example shows how to display CPU capacity and utilization information for the route processor, the switch processor, and the LAN module in the Cisco 7600 series router:
Router# show platform hardware capacity cpu
CPU Resources
CPU utilization: Module 5 seconds 1 minute 5 minutes
1 RP 0% / 0% 1% 1%
1 SP 5% / 0% 5% 4%
7 69% / 0% 69% 69%
8 78% / 0% 74% 74%
Processor memory: Module Bytes: Total Used %Used
1 RP 176730048 51774704 29%
1 SP 192825092 51978936 27%
7 195111584 35769704 18%
8 195111584 35798632 18%
I/O memory: Module Bytes: Total Used %Used
1 RP 35651584 12226672 34%
1 SP 35651584 9747952 27%
7 35651584 9616816 27%
8 35651584 9616816 27%
Router#
This example shows how to display EOBC-related statistics for the route processor, the switch processor, and the DFCs in the Cisco 7600 series router:
This example shows how to display the current and peak switching utilization:
Router# show platform hardware capacity fabric
Switch Fabric Resources
Bus utilization: current is 100%, peak was 100% at 12:34 12mar45
Fabric utilization: ingress egress
Module channel speed current peak current peak
1 0 20G 100% 100% 12:34 12mar45 100% 100% 12:34 12mar45
1 1 20G 12% 80% 12:34 12mar45 12% 80% 12:34 12mar45
4 0 20G 12% 80% 12:34 12mar45 12% 80% 12:34 12mar45
13 0 8G 12% 80% 12:34 12mar45 12% 80% 12:34 12mar45
Router#
This example shows how to display information about the total capacity, the bytes used, and the percentage that is used for the Flash/NVRAM resources present in the system:
This example shows how to display SPAN information:
Router# show platform hardware capacity monitor
SPAN Resources
Source sessions: 2 maximum, 0 used
Type Used
Local 0
RSPAN source 0
ERSPAN source 0
Service module 0
Destination sessions: 64 maximum, 0 used
Type Used
RSPAN destination 0
ERSPAN destination (max 24) 0
Router#
This example shows how to display the capacity and utilization of resources for Layer 3 multicast functionality:
Router# show platform hardware capacitymulticast
L3 Multicast Resources
IPv4 replication mode: ingress
IPv6 replication mode: ingress
Bi-directional PIM Designated Forwarder Table usage: 4 total, 0 (0%) used
Replication capability: Module IPv4 IPv6
5 egress egress
9 ingress ingress
MET table Entries: Module Total Used %Used
5 65526 6 0%
Router#
This example shows how to display information about the system power capacities and utilizations:
Router# show platform hardware capacity power
Power Resources
Power supply redundancy mode: administratively combined
operationally combined
System power: 1922W, 0W (0%) inline, 1289W (67%) total allocated
Powered devices: 0 total
Router#
This example shows how to display the capacity and utilization of QoS policer resources per EARL in the Cisco 7600 series router:
Router# show platform hardware capacity qos
QoS Policer Resources
Aggregate policers: Module Total Used %Used
1 1024 102 10%
5 1024 1 1%
Microflow policer configurations: Module Total Used %Used
1 64 32 50%
5 64 1 1%
Router#
This example shows how to display information about the key system resources:
Router# show platform hardware capacity system
System Resources
PFC operating mode: PFC3BXL
Supervisor redundancy mode: administratively rpr-plus, operationally rpr-plus
Switching Resources: Module Part number Series CEF mode
5 WS-SUP720-BASE supervisor CEF
9 WS-X6548-RJ-45 CEF256 CEF
Router#
This example shows how to display VLAN information:
Displays the packet drop and performance counters of the central rewrite engine on supervisors and line cards.
show platform hardware capacity rewrite-engine
To display the packet drop and performance counters of the central rewrite engine on supervisors and line cards, use the
showplatformhardwarecapacityrewrite-enginecommand in privileged EXEC mode.
Displays the central rewrite engine drop counter values.
performance
Displays the central rewrite engine current performance counter values or the performance rate.
slotnumber
(Optional) Displays the counter values for the module in the specified slot. If no slot is specified, the counters are displayed for each slot.
rate[sample_interval]
(Optional) Displays the drop rate or rewrite rate for a sample interval in msec between 1 and 1000. The default interval is 50 msec.
details
(Optional) Displays each individual drop counter with its name and register ID number. This keyword is not available with the
performancekeyword.
Command Default
If the sample interval is not specified, the default interval is 50 msec.
Command Modes
Privileged EXEC
Command History
Release
Modification
12.2(33)SXI
This command was introduced.
15.1(1)S
Support was added for Cisco 7600 routers. This command replaces the
show platform hardware central-rewritecommand.
Usage Guidelines
In the output of the
showplatformhardwarecapacityrewrite-engineperformance command output, a value of �N/A� means the slot/channel has a rewrite engine, but does not support performance counters.
Examples
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the packet drop counters of the central rewrite engine in all installed supervisors and line cards:
Router# show platform hardware capacity rewrite-engine drop
slot channel packet drops total overruns
----+---------+-----------------+------------------+
1 0 0 0
5 0 15440040 22
7 0 44 0
7 1 0 0
Examples
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the packet drop counters of the central rewrite engine in all installed supervisors and line cards:
Router# show platform hardware capacity rewrite-engine drop
slot channel packet drops total overruns
----+---------+-----------------+------------------+
1 0 0 0
5 0 15440040 22
7 0 44 0
7 1 0 0
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays a detailed report of the packet drop counters of the module in slot 1:
Router# show platform hardware capacity rewrite-engine drop slot 1 details
slot channel drop_id description packet drops total overruns
----+-------+-------+--------------------+----------------+--------------+
1 0 0x5ED DROP NON BPDU 0 0
1 0 0x5EB DROP BPDU 0 0
1 1 0x5ED DROP NON BPDU 0 0
1 1 0x5EB DROP BPDU 0 0
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the packet drop counters of the module in slot 5 over the default sample interval of 50 msec:
Router# show platform hardware capacity rewrite-engine drop slot 5 rate
slot channel drop rate [pps] overrun [Y/N]
----+---------+----------------------+-------------+
5 0 120079 Y
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the packet drop counters of the module in slot 5 over a sample interval of 20 msec:
Router# show platform hardware capacity rewrite-engine drop slot 5 rate 20
slot channel drop rate [pps] overrun [Y/N]
----+---------+----------------------+-------------+
5 0 180000 N
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the performance counters of the central rewrite engine in all installed supervisors and line cards:
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the performance counters of the module in slot 5:
The following sample output of the
show platform hardware capacity rewrite-engine dropcommand displays the performance counters of the module in slot 5 over the default sample interval of 50 msec:
Router# show platform hardware capacity rewrite-engine performance slot 5 rate
slot channel perf_id description packet rate[pps] overrun [Y/N]
----+-------+-------+--------------------+----------------+--------------+
5 0 0xBE FAB RX 0 11680 N
5 0 0xC0 FAB RX 1 0 N
5 0 0x112 FAB TX 0 11680 N
5 0 0x116 FAB TX 1 0 N
5 0 0x299 REPLICATION ML3 0 N
5 0 0x29A REPLICATION ML2 0 N
5 0 0x29B RECIRC L2 0 N
5 0 0x29C RECIRC L3 0 N
5 0 0x295 SPAN TX 0 5840 N
5 0 0x296 SPAN TX 1 5840 N
5 0 0x297 SPAN RX 0 0 N
5 0 0x298 SPAN RX 1 0 N
5 0 0x29D SPAN TERMINATION 0 N
Interface type. The table in the “Usage Guidelines” contains a list of interface types.
number
Port number on the selected interface.
plimqosinputmap
Physical Line Interface Module (PLIM) QoS input mapping information.
serial
Serial interface.
slot/subslot/port/t1- number:channel-group
The following applies to Channelized T3 shared port adapters:
slot/--Chassis slot where the Cisco ASR 1000 Series SPA interface processor (SIP) is installed.
subslot/--Secondary slot number of the SIP where the Cisco ASR 1000 Series shared port adapter (SPA) is installed.
port/--Interface number on the SPA.
t1-number--T1 time slot in the T3 line. The value can be from 1 to 28.
channel-group--Number 0 to 23 of the DS0 link on the T1 channel.
Note
When a port on a Channelized T3 SPA is configured to be in unchannelized mode, only the slot/subslot/port/ arguments are used to specify the unchannelized T3 interface. The t1-number and channel-group arguments are not used.
slot/subslot/port: channel-group
The following applies to Channelized T1/E1 shared port adapters:
slot/--Chassis slot where the Cisco ASR 1000 Series SPA interface processor (SIP) is installed.
subslot/--Secondary slot number of the SIP where the Cisco ASR 1000 Series shared port adapter (SPA) is installed.
port--Interface number on the SPA.
channel-group--Number 0 to 30 of the DS0 link on the T1 channel.
slot/subslot/port [.subint]
The following applies to shared port adapters other than the Channelized T3 or Channelized T1/E1 shared port adapters:
slot/--Chassis slot where the Cisco ASR 1000 Series SPA interface processor (SIP) is installed.
subslot/--Secondary slot number of the SIP where the Cisco ASR 1000 Series shared port adapter (SPA) is installed.
port--Interface number on the SPA.
(Optional) .subint--Subinterface number (for those SPAs that support subinterface configuration).
Command Default
No default behavior or values
Command Modes
Privileged EXEC (#)
Diagnostic (diag)
Command History
Release
Modification
Cisco IOS XE Release 2.1
This command was introduced on the Cisco ASR 1000 Series Routers.
Usage Guidelines
This command displays platform-specific information and configuration information related to a specific interface.
The table below lists the interface types.
Table 26 Interface Types
Interface Type
Description
async
Asynchronous interface
auto-template
Auto-template interface
bvi
Bridge group virtual interface
ctunnel
Connectionless Network Service (CLNS) tunnel (CTunnel) interface
Packets can be classified based on the IP precedence, IPv6 traffic class, MPLS experimental bits, or VLAN TOS bits. In the following example, incoming packets with IP precedence 6 or 7, IPv6 packets with traffic class 46, and MPLS packets with experimental bits 6 or 7 are classified as high priority packets:
Specifies ZL30138 SONET/SDH/10GbE System Synchronizer.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(33)SRD1
This command was introduced on the Cisco 7600 series routers for ES+ line cards only.
Examples
The following example shows how the
showplatformhardwarenetwork-clockscommand is used to display network clocks:
Router# show platform hardware network-clocks Local Loop Timing: Port 1: N Port 2: N Port 3: N Port 4: NBackplane Bus Status and Source: Primary : Disabled, Port 0 RX_DEMAP Clock Secondary : Disabled, Port 0 RX_DEMAP Clock BITS : Disabled, Port 0 RX_DEMAP ClockZL30138 Configuration and Status: DPLL1: Failure (4) Mode of Operation : Manual Freerun Selected Reference : 0 Ref0 Priority : 15 Ref1 Priority : 15 Ref2 Priority : 15 Ref3 Priority : 15 Ref4 Priority : 15 Ref5 Priority : 15 Ref6 Priority : 15 Ref7 Priority : 15 Reference Monitoring: Custom A frequency 25000 kHz Ref# SCM CFM GST PFM Mode Detected ---------------------------------------------------------- 0 1 1 1 1 CustA 38.88 MHz 1 1 1 1 1 CustA 19.44 MHz 2 0 0 0 0 Auto 77.76 MHz 3 1 1 1 1 CustA not detected 4 1 1 1 1 Auto not detected 5 1 1 1 1 Auto not detected 6 1 1 1 1 Auto not detected 7 1 1 1 1 Auto not detectedBITS Configuration and Status: Signal Type : T1 ESF Framing Clock Divider : 1.544 MHz
Related Commands
Command
Description
clock source
Specifies the interface clock source type.
network-clock select
Selects a source of network clock.
shownetwork-clocks
Displays the current configured and active network clock sources.
show platform hardware qfp active interface if-name statistics
To display the statistics of packet drops for each interface in the Packet Processor Engine (PPE), use the
show platform hardware qfp active interface if-name
statistics command in privileged EXEC mode.
show platform hardware qfp active interface if-name
type number
statistics
Syntax Description
This command has no arguments or keywords.
Command Default
No default behavior or values.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 2.0
This command was introduced.
Usage Guidelines
You can use this command for troubleshooting the problems on an interface in a PPE by analyzing the statistics of packet drops.
Examples
The following sample output from the
show platform hardware qfp active interface if-name statistics command displays the statistics of packet drops on the Gigabit Ethernet interface 0/0/0.781 interface:
Router # show platform hardware qfp active GigabitEthernet0/0/0.781 if-name statistics
----------------------------------------------------------------
Receive Stats Packets Octets
----------------------------------------------------------------
Ipv4 2 322
Ipv6 0 0
Tag 0 0
McastIpv4 0 0
McastIpv6 0 0
Other 3 204
----------------------------------------------------------------
Transmit Stats Packets Octets
----------------------------------------------------------------
Ipv4 2 178
Ipv6 0 0
Tag 0 0
McastIpv4 0 0
McastIpv6 0 0
Other 0 0
----------------------------------------------------------------
Input Drop Stats Packets Octets
---------------------------------------------------------------
Ipv4uRpfStrictFailed 5 590
Ipv6uRpfStrictFailed 5 590
----------------------------------------------------------------
Output Drop Stats Packets Octets
----------------------------------------------------------------
The Egress drop stats were all zero
----------------------------------------------------------------
Drop Stats Summary:
note: 1) these drop stats are only updated when PAL
reads the interface stats.
2) the interface stats include the subinterface
Interface Rx Pkts Tx Pkts
---------------------------------------------------------------------------
GigabitEthernet0/0/0.781 25 0
The following table describes the fields shown in the display.
Table 27 show platform hardware qfp active interface if-name statistics Field Descriptions
Field
Description
Receive Stats
Number of packets received.
Packets
Number of packets that are received.
Octets
Total number of bytes of the packets that are received.
Transmit Stats
Number of packets that are transmitted on an interface.
Input Drop Stats
The drop cause and the number of incoming packets that are dropped.
pv4uRpfStrictFailed - Specifies the number and bytes of packets that are dropped with this drop cause.
Ipv6uRpfStrictFailed - Specifies the number and bytes of packets that are dropped with this drop cause
Packets
Number of packets that are transmitted.
IPv4uRpfStrictFailed received 5 packets.
IPv6uRpfStrictFailed received 5 packets.
Octets
Total number of bytes of the packets that are received.
IPv4uRpfStrictFailed received 590 bytes of packets.
IPv6uRpfStrictFailed received 590 bytes of packets.
Output Drop Stats
Specifies the drop cause and the number of outgoing packets that are dropped.
Interface
Name of the interface.
Rx Pkts
Number of packets received on an interface.
Tx Pkts
Number of packets transmitted on an interface.
Related Commands
Command
Description
show platform hardware qfp active statistics drop
Displays the statistics of packet drops on all the interfaces in a PPE.
show platform hardware qfp active feature cef-mpls urpf
To confirm and display the hardware information pertaining to Cisco Express Forwarding (CEF) Multiprotocol Label Switching (MPLS) Unicast Reverse Path Forwarding (uRPF) feature on a Cisco QuantumFlow Processor (QFP) of the Cisco ASR 1000 Series Aggregation Services Routers, use the
show platform hardware qfp active feature cef-mpls urpf command in privileged EXEC mode.
show platform hardware qfp active feature cef-mpls urpf
interface-name ip-version
ip version
Syntax Description
ip-version
Name of the interface.
interface-name
Version of the IP. Valid values are IPv4 and IPv6.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 2.0S
This command was introduced on the Cisco ASR 1000 Series Aggregation Services Routers.
Examples
The following is a sample output of the show platform hardware qfp active feature cef-mpls urpf command:
Device# show platform hardware qfp active feature cef-mpls urpf GigabitEthernet 0/0/0.777 ipv4
=== uRPF Information ===
uRPF mode: Strict
allow_default_route: FALSE
allow_self_ping: FALSE
Related Commands
The table below describes the significant fields shown in the display.
Table 28 show platform hardware qfp active feature cef-mpls urpf Field Descriptions
Field
Description
uRPF mode
Mode of uRPF. Valid values are Strict or Loose..
allow_default_route
State showing whether the QFP allows the use of the default route in the source verification process or not. Valid values are TRUE or FALSE.
allow_self_ping
State showing whether the QFP allows the source of the packet to ping itself during the source verification process or not. Valid values are TRUE or FALSE.
show platform hardware qfp active feature cef-mpls prefix ip
To display the interface name along with the interface descriptor block (IDB) information, use the
showplatformhardwareqfpactivefeaturecef-mplsprefixip command in privileged EXEC.
(Optional) Displays information about VPN Routing and Forwarding (VRF).
id
(Optional) Information about the particular VRF instance. The range is from 0 to 4294967295. If no VRF ID is specified, information about the global VRF, which is the prefix in global routing table, is displayed.
exact
(Optional) Find and displays the exact match of the IPV4 prefix.
brief
(Optional) Displays a summary of prefix information.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
12.2(33)XNB
This command was introduced on the Cisco ASR 1000 Series Routers.
Cisco IOS XE Release 3.4S
This command was integrated into Cisco IOS Release XE 3.4S. Support for IP Fast Reroute (IP FRR) was added.
Examples
The following is sample output from theshowplatformhardwareqfpactivefeaturecef-mplsprefixip command:
The following example shows the output with the names of each interface when there are multiple interfaces in the unicast reverse path forwarding (uRPF) path list:
Router#
show platform hardware qfp active feature cef-mpls prefix ip 0.0.0.0/2 vrf
show platform hardware qfp active feature cef-mpls prefix mpls
To display the complete Output Chain Element (OCE) chains used for
handling the incoming Multiprotocol Label Switching (MPLS) packets with a
particular label, use the show platform hardware qfp active feature cef-mpls
prefix mpls command in the privileged EXEC mode.
MPLS label containing a 20-bit label value, a 3-bit
experimental field, a 1-bit bottom-of-stack indicator, and an 8-bit
Time-to-Live (TTL) field.
exact
Displays all the OCE chains that are used for handling the
incoming MPLS packets with a particular label.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 3.8S
This command was introduced on the Cisco ASR 1000 Series
Aggregation Services Routers.
Examples
The following is sample output from the show platform hardware qfp
active feature cef-mpls prefix mpls mpls-label exact command displaying all the
OCE chains used for handling incoming MPLS packets with a particular label:
Router# show platform hardware qfp active feature cef-mpls prefix mpls 17 exact
Gtrie Node Type: Leaf Node
HW Content: : 0a000000 00000f00 00000000 8bb08a30
QPPB QoS Precedence valid: 0
QoS Precedence: 0
QPPB QoS Group valid: 0
QoS Group: 0
BGPPA Traffic Index valid: 0
BGPPA Traffic Index: 0
TBLF refcount: 2
TBLF application lf handle: 0
CTS src_sgt: 0
CTS dst_sgt: 0
Prefix Length: 20
Prefix: 00 0d 00
Lisp local eid: 0
Lisp remote eid: 0
Lisp locator status bits: 0
Lisp dynamic configured eid: 0
Lisp dynamic discovered eid: 0
OCE Type: EOS OCE, Number of children: 2
Next HW OCE Ptr: : 0x8bb07e10, 0x8bb07e00
OCE Type: REPLICATE OCE, Number of children: 2
Replica_node: : 0x8ca90a20
Next HW OCE Ptr: : 0x8bb07eb0, 0x8bb08840
OCE Type: Label OCE, Number of children: 1
Label flags: : 64
Num Labels: : 1
Num Bk Labels: : 0
Out Labels: : 1048577
Next HW OCE Ptr: : 0x8bb07e60
OCE Type: Interface OCE, Number of children: 1
Next HW OCE Ptr: : 0x8bb07e40
Interface Name: Lspvif20
OCE Type: Lookup OCE, Number of children: 0
Lookup flags: : 1
Table Type: : 0
Lookup table ID: : 0
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 88
Out Backup Labels: : 0
Next HW OCE Ptr: : 0x8bb06ca0
OCE Type: Adjacency, Number of children: 0
Adj Type: : MPLS Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 0
Interface Name: GigabitEthernet0/1/0
Encap: : 00 0e 39 88 70 19 00 21 d8 60 c0 10 88 47
Next Hop Address: : 0f000001 00000000 00000000 00000000
Next HW OCE Ptr: : 00000000
OCE Type: REPLICATE OCE, Number of children: 2
Replica_node: : 0x8ca90a00
Next HW OCE Ptr: : 0x8bb07e70, 0x8bb08840
OCE Type: Label OCE, Number of children: 1
Label flags: : 64
Num Labels: : 1
Num Bk Labels: : 0
Out Labels: : 1048577
Next HW OCE Ptr: : 0x8bb07e50
OCE Type: Interface OCE, Number of children: 1
Next HW OCE Ptr: : 0x8bb001f0
Interface Name: Lspvif20
OCE Type: Lookup OCE, Number of children: 0
Lookup flags: : 0
Table Type: : 1
Lookup table ID: : 2
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 88
Out Backup Labels: : 0
Next HW OCE Ptr: : 0x8bb06ca0
OCE Type: Adjacency, Number of children: 0
Adj Type: : MPLS Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 0
Interface Name: GigabitEthernet0/1/0
Encap: : 00 0e 39 88 70 19 00 21 d8 60 c0 10 88 47
Next Hop Address: : 0f000001 00000000 00000000 00000000
Next HW OCE Ptr: : 00000000
The fields shown in the display are self-explanatory.
show platform hardware qfp active feature multicast
To display the complete Output Chain Element (OCE) chains that are
connected by each leaf node in the multicast replication tree for a particular
output path in the Cisco QuantumFlow Processor (QFP) active feature on the
Cisco ASR 1000 Series Aggregation Services Routers, use the show platform
hardware qfp active feature multicast command in the privileged EXEC mode.
Version of the IP address. It can be one of the following
values:
v4mcast—IPv4.
v6mcast—IPv6.
ip-address-mgroup
Multicast group’s IP address.
ip-address-source
(Optional) Source prefix for the IP address.
vrf
Displays information present in a particular VRF.
vrf-id
ID of the VRF.
extension
Displays the entire OCE that is connected by each leaf node
in the multicast replication tree for a particular output path.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 3.8S
This command was introduced on the Cisco ASR 1000 Series
Aggregation Services Routers.
Examples
The following is sample output from the show platform hardware qfp
active feature multicast v4mcast command displaying all the OCE chains used for
forwarding traffic to a particular IPv4 multicast address:
Router# show platform hardware qfp active feature multicast v4mcast 239.1.1.1/32 vrf 2 extension
Root: 0x1187fc58
Flags: 0x000002
First leaf: 0x11887fa8
Number of nodes: 1
Number of leaves: 3
RPF i/f: 0x01fff7
Punt limit counter: 200
NS DCS Punt limit: 0x000001
RPF Fast Convergence Flags: 00000000
Secondary RPF interface: 00000000
RPF Fast Convergence Timer: 0
Extended leaf address: 0x89f80060
Node: 0x1187fc58
Cumulative Free Space: : 4
Cumulative Weight: : 3
Number of Children: : 3
Hw Addr: : 0x8b969440
Node Flags: : 0x000004
Software Child Ptr: : 0x1187fce0, 0x1187fd60, 0x11887fa8, 00000000
00000000, 00000000, 00000000
Hardware Child Ptr: : 0x89f8e440, 0x89f8e450, 0x89f8e460, 00000000
00000000, 00000000, 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11884b48
HW OCE chain ptr: 0x895d59a0
OCE Type: Adjacency, Number of children: 1
Adj Type: : IPV4 Adjacency
Encap Len: : 0
L3 MTU: : 9216
Adj Flags: : 64
Fixup Flags: : 0
Interface Name: Lspvif0
Next Hop Address: : 00000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 0x895d5940
OCE Type: REPLICATE OCE, Number of children: 1
Replica_node: : 0x89fab440
Next HW OCE Ptr: : 0x895d5ab0
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 17
Out Backup Labels: : 0
Next HW OCE Ptr: : 0x895d5a70
OCE Type: Label OCE, Number of children: 1
Label flags: : 65
Num Labels: : 1
Num Bk Labels: : 0
Out Labels: : 3
Next HW OCE Ptr: : 0x895d59f0
OCE Type: Adjacency, Number of children: 0
Adj Type: : MPLS Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 0
Interface Name: GigabitEthernet0/1/0
Encap: : 00 24 14 f4 9d 00 00 21 d8 d4 a5 10 88 47
Next Hop Address: : 0b000002 00000000 00000000 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000002
SW OCE chain ptr: 0x118830d0
HW OCE chain ptr: 0x895d58f0
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV4 Adjacency
Encap Len: : 20
L3 MTU: : 1480
Adj Flags: : 0
Fixup Flags: : 2
Interface Name: Tunnel1
Encap: : 45 00 00 00 00 00 00 00 ff 67 39 94 c0 00 01 01
c0 00 01 01
Next Hop Address: : 00000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x1186c250
HW OCE chain ptr: 0x895d5650
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV4 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/2
Encap: : 01 00 5e 00 00 00 00 21 d8 d4 a5 12 08 00
Next Hop Address: : e1000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x1186d478
HW OCE chain ptr: 0x895d5660
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV4 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/4
Encap: : 01 00 5e 00 00 00 00 21 d8 d4 a5 14 08 00
Next Hop Address: : e1000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
The fields shown in the display are self-explanatory.
The following is sample output from the show platform hardware qfp
active feature multicast v6mcast command displaying all the OCE chains used for
forwarding traffic to a particular IPv6 multicast address:
Router# show platform hardware qfp active feature multicast v6mcast FF04::10/128 vrf 503316482 extension
Root: 0x11b6c700
Flags: 0x000002
First leaf: 0x11e55bc8
Number of nodes: 1
Number of leaves: 3
RPF i/f: 0x01fff3
Punt limit counter: 200
NS DCS Punt limit: 0x000001
RPF Fast Convergence Flags: 00000000
Secondary RPF interface: 00000000
RPF Fast Convergence Timer: 0
Extended leaf address: 0x8ba18c90
Node: 0x11b6c700
Cumulative Free Space: : 4
Cumulative Weight: : 3
Number of Children: : 3
Hw Addr: : 0x8ba06c60
Node Flags: : 0x000004
Software Child Ptr: : 0x11b6dcb0, 0x11b6e0b0, 0x11e55bc8, 00000000
00000000, 00000000, 00000000
Hardware Child Ptr: : 0x8ba24060, 0x8ba24070, 0x8ba245f0, 00000000
00000000, 00000000, 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11b71af0
HW OCE chain ptr: 0x895ffa40
OCE Type: Adjacency, Number of children: 1
Adj Type: : IPV6 Adjacency
Encap Len: : 0
L3 MTU: : 9216
Adj Flags: : 64
Fixup Flags: : 0
Interface Name: Lspvif0
Next Hop Address: : 00000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 0x895ffa20
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 2
Out Backup Labels: : 2
Next HW OCE Ptr: : 0x895ff9f0
OCE Type: Adjacency, Number of children: 1
Adj Type: : MPLS Adjacency
Encap Len: : 0
L3 MTU: : 9216
Adj Flags: : 64
Fixup Flags: : 0
Interface Name: Lspvif0
Next Hop Address: : 00000000 00000000 00000000 00000000
Next HW OCE Ptr: : 0x895ff980
OCE Type: REPLICATE OCE, Number of children: 1
Replica_node: : 0x8ba51060
Next HW OCE Ptr: : 0x895ffa60
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 17
Out Backup Labels: : 0
Next HW OCE Ptr: : 0x895ff7b0
OCE Type: Adjacency, Number of children: 0
Adj Type: : MPLS Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 0
Interface Name: GigabitEthernet0/1/0
Encap: : 00 24 14 f4 9d 00 00 21 d8 d4 a5 10 88 47
Next Hop Address: : 0b000002 00000000 00000000 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11b6b800
HW OCE chain ptr: 0x895ff6a0
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV6 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/2
Encap: : 33 33 00 00 00 00 00 21 d8 d4 a5 12 86 dd
Next Hop Address: : ff0e0000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11b6ba08
HW OCE chain ptr: 0x895ff6e0
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV6 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/4
Encap: : 33 33 00 00 00 00 00 21 d8 d4 a5 14 86 dd
Next Hop Address: : ff0e0000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x00000a
SW OCE chain ptr: 0x11b6de20
HW OCE chain ptr: 0x895ff770
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV6 Adjacency
Encap Len: : 4
L3 MTU: : 1460
Adj Flags: : 2
Fixup Flags: : 2
Interface Name: Tunnel5
Encap: : f8 00 01 47
Next Hop Address: : 00000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
Root: 0x11e4f428
Flags: 00000000
First leaf: 0x11e51b90
Number of nodes: 1
Number of leaves: 3
RPF i/f: 0x0003fd
Punt limit counter: 200
NS DCS Punt limit: 0x000001
RPF Fast Convergence Flags: 00000000
Secondary RPF interface: 00000000
RPF Fast Convergence Timer: 0
Extended leaf address: 0x8ba21210
Node: 0x11e4f428
Cumulative Free Space: : 4
Cumulative Weight: : 3
Number of Children: : 3
Hw Addr: : 0x8ba0c560
Node Flags: : 0x000004
Software Child Ptr: : 0x11e424b8, 0x11e332b8, 0x11e51b90, 00000000
Root: 0x11e50f20
Flags: 00000000
First leaf: 0x11e51b90
Number of nodes: 1
Number of leaves: 3
RPF i/f: 0x0003fd
Punt limit counter: 200
NS DCS Punt limit: 0x000001
RPF Fast Convergence Flags: 00000000
Secondary RPF interface: 00000000
RPF Fast Convergence Timer: 0
Extended leaf address: 0x8ba212a0
Node: 0x11e50f20
Cumulative Free Space: : 4
Cumulative Weight: : 3
Number of Children: : 3
Hw Addr: : 0x8ba0c560
Node Flags: : 0x000004
Software Child Ptr: : 0x11e424b8, 0x11e56f98, 0x11e51b90, 00000000
00000000, 00000000, 00000000
Hardware Child Ptr: : 0x8ba247a0, 0x8ba24750, 0x8ba24740, 00000000
00000000, 00000000, 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11b6ba08
HW OCE chain ptr: 0x895ff6e0
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV6 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/4
Encap: : 33 33 00 00 00 00 00 21 d8 d4 a5 14 86 dd
Next Hop Address: : ff0e0000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000009
SW OCE chain ptr: 0x11b71af0
HW OCE chain ptr: 0x895ffa40
OCE Type: Adjacency, Number of children: 1
Adj Type: : IPV6 Adjacency
Encap Len: : 0
L3 MTU: : 9216
Adj Flags: : 64
Fixup Flags: : 0
Interface Name: Lspvif0
Next Hop Address: : 00000000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 0x895ffa20
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 2
Out Backup Labels: : 2
Next HW OCE Ptr: : 0x895ff9f0
OCE Type: Adjacency, Number of children: 1
Adj Type: : MPLS Adjacency
Encap Len: : 0
L3 MTU: : 9216
Adj Flags: : 64
Fixup Flags: : 0
Interface Name: Lspvif0
Next Hop Address: : 00000000 00000000 00000000 00000000
Next HW OCE Ptr: : 0x895ff980
OCE Type: REPLICATE OCE, Number of children: 1
Replica_node: : 0x8ba51060
Next HW OCE Ptr: : 0x895ffa60
OCE Type: Label OCE, Number of children: 1
Label flags: : 0
Num Labels: : 1
Num Bk Labels: : 1
Out Labels: : 17
Out Backup Labels: : 0
Next HW OCE Ptr: : 0x895ff7b0
OCE Type: Adjacency, Number of children: 0
Adj Type: : MPLS Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 0
Interface Name: GigabitEthernet0/1/0
Encap: : 00 24 14 f4 9d 00 00 21 d8 d4 a5 10 88 47
Next Hop Address: : 0b000002 00000000 00000000 00000000
Next HW OCE Ptr: : 00000000
OCE Flags: : 0x000003
SW OCE chain ptr: 0x11b6b800
HW OCE chain ptr: 0x895ff6a0
OCE Type: Adjacency, Number of children: 0
Adj Type: : IPV6 Adjacency
Encap Len: : 14
L3 MTU: : 1500
Adj Flags: : 0
Fixup Flags: : 64
Interface Name: GigabitEthernet0/1/2
Encap: : 33 33 00 00 00 00 00 21 d8 d4 a5 12 86 dd
Next Hop Address: : ff0e0000 00000000 00000000 00000000
Lisp locator status: : 00000000
Next HW OCE Ptr: : 00000000
The fields shown in the display are self-explanatory.
show platform hardware qfp statistics drop
To display the statistics of all the dropped packets on the Embedded Services Processor (ESP), use the
show platform
hardwareqfp
active statistics drop command in privileged EXEC mode.
show platform hardware qfp
{ active | standby }
statistics drop
Syntax Description
active
Active forwarding processor.
standby
Standby forwarding processor .
Command Default
No default behavior or values.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 2.0
This command was introduced.
Cisco IOS XE Release 3.5
This command was modified for Cisco ASR 1000 Series Routers. A new drop type, PPPoECAC, was added to theshow platform hardware qfp active statistics drop command.
Usage Guidelines
You can use this command for troubleshooting the problems on all the interfaces in a PPE by analyzing the statistics of packet drops.
You can use this command for troubleshooting the problems on all the interfaces in a packet processing engine (PPE) by analyzing the statistics of packet drops.
To improve the CPU utilization and memory of the Route Processor (RP) on Cisco ASR 1000 Series Router, the SRSM hardware feature has been implemented. When Call Admission Control (CAC) is enabled and the CAC threshold level is reached, the PPPoE packets are punted on the Embedded Service Processor (ESP) instead of being sent to the RP. Managing the PPPoE packets at the ESP level helps in controlling and minimizing RP CPU and memory utilization. A new drop type, PPPoECAC, is added to theshow platform hardware qfp active statistics drop command which indicates the number of PPPoE Active Discovery Initiation (PADI) and PPPoE Active Discovery Request (PADR) packets rejected by the hardware due to call admission control.
Note
The
show call admission statistics command shows how many packets were dropped by the RP and the
show platform hardware qfp active statistics drop command indicates how many packets were dropped by the ESP. A small number of packets are still dropped by the RP because it takes time for the drop message to reach the ESP. The actual number of packets dropped by SRSM is the total number of packets dropped by
show call admission statistics and
show platform hardware qfp active statistics drop commands.
Examples
The following sample output from the
show platform hardware
qfp
active
statistics
drop command displays the statistics of packet drops on all the interfaces in a PPPoE:
Router# show platform hardware qfp active statistics drop
Global Drop Stats Packets Octets
-------------------------------------------------------------------------
BadUidbSubIdx 59187 4918277
Disabled 4725 373436
Ipv4NoAdj 219 9468
Ipv4uRpfStrictFailed 10 1180
Ipv6uRpfStrictFailed 10 1180
UnconfiguredIpv4Fia 1589 132013
The following sample output of the
show platform hardware qfp active statistics drop command shows the PPPoECAC packets dropped on the ESP when the CAC threshold level is reached:
Router# show platform hardware qfp active statistics drop
Global Drop Stats Packets Octets
-------------------------------------------------------------------------
BadUidbIdx 80 7901
BadUidbSubIdx 40374 2860531
Disabled 4765 375064
InjectErr 64 8350
Ipv4NoAdj 8 776
Ipv4NoRoute 52608 5482626
Ipv6NoAdj 1 79
MplsIpv6FragReq 1 1515
UnconfiguredIpv4Fia 2412 215692
PPPoECAC 4648 171976
The following table describes the fields shown in the display.
Table 29 show platform hardware qfp active statistics drop Field Descriptions
Field
Description
Global Drop Stats
The reason for dropping packets.
pv4uRpfStrictFailed - Specifies the number and bytes of packets that are dropped with this drop cause.
Ipv6uRpfStrictFailed - Specifies the number and bytes of packets that are dropped with this drop cause
Packets
Number of packets that are dropped.
IPv4uRpfStrictFailed dropped 10 packets.
IPv6uRpfStrictFailed dropped 10 packets.
Octets
Total number of bytes of the packets that are dropped.
IPv4uRpfStrictFailed dropped 1180 bytes of packets.
IPv6uRpfStrictFailed dropped 1180 bytes of packets.
Related Commands
Command
Description
showplatformhardwareqfpinterface
Displays information about an interface in the target flow processor.
show platform hardware qfp active interface if-name statistics
Displays the statistics of packet drops for each interface in the Packet Processor Engine (PPE).
show platform hardware qfp interface
To display information about an interface in the target flow processor, use the
show platform
hardware qfp
interface command in privileged EXEC mode.
Specifies all interfaces available on the processor.
summary
(Optional) Specifies the interface summary report.
statistics
(Optional) Specifies the statistics of transmitted and received packets.
drop_summary
(Optional) Specifies the drop status summary report.
subinterface
(Optional) Specifies the subinterface and the drop statistics.
clear_drop
(Optional) Clears the drop statistics after reading.
detail
(Optional) Shows drop cause IDs.
dsp
Specifies digital signal processor (DSP) statistics.
client
Specifies DSP client statistics.
resource
Specifies DSP client resource statistics.
dsp-resource-id
Combinet Packet Protocol (CPP) DSP resource ID.
global
Specifies DSP global statistics.
clear
Clears statistics after reading.
stream
Specifies DSP stream statistics.
stream-id
Stream ID.
if-namename
Specifies the name of an interface, interface type, and port number of the selected interface.
if-handlehandle
Specifies the quantum flow processor (QFP) interface handle number.
info
(Optional) Specifies interface information.
path
(Optional) Specifies path information.
atm
Specifies information and statistics for the ATM interface.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 2.1
This command was introduced.
Cisco IOS XE Release 2.5
This command was modified. The
cpp
keyword was changed to
qfp.
12.2(33)XNE
This command was integrated into Cisco IOS Release 12.2(33)XNE.
Cisco IOS XE Release 3.8S
This command was modified. The
path keyword was added.
Usage Guidelines
The
showplatformhardwareqfpinterface command displays information about the relationship between one interface and another in the target flow processor. In the command output, the main interface is identified if the interface is a subinterface; the group interface is identified if the interface is a member of a group; and the interfaces that are members of the group are identified if the interface is a group, bundle, or multipoint interface.
Examples
The following sample output shows information about the relationship between one interface and the other on the target flow processor:
Device# show platform hardware qfp active interface if-name Port-channel1 info
General interface information
Interface Name: Port-channel1
Platform interface handle: 36
QFP interface handle: 36
Rx uidb: 131064
Tx uidb: 131036
Channel: 0
Interface Relationships
if_h Member Interface Name
10 GigabitEthernet0/0/2
11 GigabitEthernet0/0/3
The table below describes the significant fields shown in the display.
Table 30 show platform hardware qfp interface Field Descriptions
Field
Description
Interface Name
Name of the interface requested by the
show
platform
hardware
qfp
interface command.
Platform interface handle
Number of platform interface handles displayed for the interface.
QFP interface handle
Internal identifier assigned by the QFP software for this interface.
Rx uidb
Internal identifier for the receive side of the interface.
Tx uidb
Internal identifier for the transmit side of the interface.
Channel
Internal identifier for the transmit path to which the interface is connected.
The following sample output shows the summary of the drop status of the packets:
Device# show platform hardware qfp active statistics drop
Global Drop Stats Packets Octets
-------------------------------------------------------------------------
BadUidbIdx 80 7901
BadUidbSubIdx 40374 2860531
Disabled 4765 375064
InjectErr 64 8350
Ipv4NoAdj 8 776
Ipv4NoRoute 52608 5482626
Ipv6NoAdj 1 79
MplsIpv6FragReq 1 1515
UnconfiguredIpv4Fia 2412 215692
The table below describes the significant fields shown in the display.
Table 31 show platform hardware qfp active statistics drop Field Descriptions
Field
Description
Global Drop Stats
Reason for dropping of packets.
Packets
Number of packets that are dropped.
Octets
Total number of bytes of the packets that are dropped.
The following sample output shows the statistics of the packets on an interface:
Device# show platform hardware qfp active interface if-name GigabitEthernet0/0/0.775 statistics
----------------------------------------------------------------
Receive Stats Packets Octets
----------------------------------------------------------------
Ipv4 9 810
Ipv6 0 0
Tag 0 0
McastIpv4 0 0
McastIpv6 0 0
Other 2 136
----------------------------------------------------------------
Transmit Stats Packets Octets
----------------------------------------------------------------
Ipv4 0 0
Ipv6 1 154
Tag 0 0
McastIpv4 0 0
McastIpv6 0 0
Other 0 0
----------------------------------------------------------------
Input Drop Stats Packets Octets
---------------------------------------------------------------
Ipv4NoRoute 182 22996
MplsIpv6FragReq 1 1515
UnconfiguredIpv4Fia 550 49120
----------------------------------------------------------------
Output Drop Stats Packets Octets
---------------------------------------------------------------
Ipv4NoRoute 13 3721
----------------------------------------------------------------
Drop Stats Summary:
note: 1) these drop stats are only updated when PAL
reads the interface stats.
2) the interface stats include the subinterface
Interface Rx Pkts Tx Pkts
---------------------------------------------------------------------------
GigabitEthernet0/0/0.775 3209 20
The table below describes the significant fields shown in the display.
Table 32 show platform hardware qfp active interface if-name statistics Field Descriptions
Field
Description
Receive Stats
Number of packets received through a protocol.
Packets
Number of packets transmitted through a protocol.
Octets
Total number of bytes of the packets that are dropped.
Transmit Stats
Number of packets that are transmitted on an interface.
Input Drop Stats
Drop cause and the number of incoming packets that are dropped.
Output Drop Stats
Drop cause and the number of outgoing packets that are dropped.
Interface
Name of the interface.
Rx Pkts
Number of packets received on an interface.
Tx Pkts
Number of packets transmitted on an interface.
Device# show platform hardware qfp active interface if-handle 10 path
Hardware Path Information: Port type 2 - NGIO
Ingress Path Information:
Interface ID 1
IID table entry address 0x30b61018
Input uIDB 2043
Flow Control ID 0x30b61500
Egress Path Information:
Interface ID 1
FFP output port -2
Module backplane connection index 0
Switch port ID 8
Module number 0
MAC destination address c4: a:cb:56: 0:d5
MAC source address 30:f7: d:53:f4:db
The table below describes the significant fields shown in the display.
Table 33 show platform hardware qfp active interface if-handle path Field Descriptions
Field
Description
Hardware Path Information
Type of module on which the interface exists. Possible values are NGIO and BEST_EFFORT.
Ingress Path Information
Ingress path information.
Interface ID
Identifier assigned to the interface by the module. This identifier is local to the module.
IID table entry address
Address of the table of interfaces on the module in the forwarding plane memory.
Input uIDB
Input micro-interface descriptor block (uIDB) assigned to this interface.
Flow Control ID
Identifier for the flow control structure if the interface traffic is flow controlled.
Egress Path Information
Egress path information.
FFP output port
Port of the forwarding process that handles traffic on the interface.
Module backplane connection index
Identifier for the backplane connection of the module that handles the traffic on the interface.
Switch port ID
Identifier for the backplane switchport that handles the traffic for the interface.
Module number
Module identifier.
MAC destination address
MAC address in the headers of the packets that traverse the backplane switch.
Device# show platform hardware qfp active interface if-handle 14 path
Hardware Path Information:
Ingress Path Information:
Look-up class 1
Remap table entry:
SPA Format 2
Valid flag 1
Marmot channel 0
Indirect flag 1
Input uIDB 1019
Egress Path Information:
Marmot header 0x2000000
SPA type 2
SPA header length 4
SPA header 0x0 0x0 0x0 0x0
LP small header 0xd2 0xa9 0xe0 0x10
HP header 0x0 0x0 0x1 0x0
Cntl header 0xfa 0x28 0xd4 0x10
The table below describes the significant fields shown in the display.
Table 34 show platform hardware qfp active interface if-handle path Field Descriptions
Field
Description
Hardware Path Information
Type of module on which the interface exists.
Ingress Path Information
Ingress path information follows.
Look-up class
Look-up method used to identify the ingress interface.
Remap table entry
Entry of the remap table of the interface follows.
SPA format
Format of the Shared Port Adapter (SPA) header.
Valid Flag
Flag indicating whether entry in the remap table is valid. 1 is valid.
Marmot Channel
Channel in the Marmot chip through which traffic passes.
Indirect flag
Flag indicating whether the ingress interface is determined indirectly through the SPA header.
Input uIDB
Input micro-interface descriptor block (uIDB) assigned to the interface.
Egress Path Information
Egress path information follows.
Marmot header
Marmot header in the egress packets.
SPA type
Format of the SPA header.
SPA header length
Length of the egress SPA header, in bytes.
SPA header
Default SPA header of the egress packets.
LP small header
SPA header used for low priority (LP) packets.
HP header
SPA header used for high priority (HP) packets.
Cntl header
SPA header used for control packets.
Related Commands
Command
Description
showinterfaces
Displays statistics for all interfaces configured on a device or on an access server.
show platform hardware slot
To display information about the processor in a chassis slot, use the
show
platform
hardware
slot
command in privileged EXEC or diagnostic mode.
Displays EOBC interface remote monitoring (RMON) information (for Cisco Technical Support only).
status
Displays EOBC interface status information (Physical Line Interface Module [PLIM] status and serializer/deserializer [SerDes] status are for Cisco Technical Support only).
switchstatistics
Displays EOBC switch statistics.
brief
Displays summary information.
detail
Displays detailed information (for Cisco Technical Support only). This keyword is optional for PLIM buffer settings.
fanstatus
Displays fan software status.
io-port
Displays I/O port information.
ledstatus
Displays LED states.
mcustatus
Displays microcontroller unit (MCU) hardware status (for Cisco Technical Support only).
raw
(Optional) Displays MCU unparsed raw data (for Cisco Technical Support only).
plim
Displays PLIM information.
buffersettings
Displays PLIM buffer settings (for Cisco Technical Support only).
cpu
Displays CPU hyper threading (HT) bus information (for Cisco Technical Support only).
qosinputbandwidth
Displays PLIM quality of service (QoS) input bandwidth information.
registers reg
It is the register name (for Cisco Technical Support only).
statistics
Displays statistics information.
internal
(Optional) Displays Cisco internal information (for Cisco Technical Support only).
sensor
Displays sensor information (for Cisco Technical Support only).
consumer
Displays sensor information from the consumer process (for Cisco Technical Support only).
producer
Displays sensor information from the producer process (for Cisco Technical Support only).
id
Displays the consumer or producer sensor ID number (for Cisco Technical Support only).
all
Displays a brief view of all sensors (for Cisco Technical Support only).
This command was modified. The minimum bandwidth and the priority mode that cannot be configured in Strict Priority mode are not displayed in the output. The HP policer BW field was added to the output.
Cisco IOS XE Release 3.8S
This command was modified. References to SIP (Cisco ASR 1000 Series Shared Port Adaptor Interface Processors) in command options were replaced with SM (Cisco Services-Ready Engine [SRE] service module) for Cisco ISR 4400 Series Routers only.
Examples
The following sample output from the show platform hardware slot 0 eobc interface primary status
command displays EOBC interface status for a SIP in chassis slot 0. This command provides the status of the EOBC in the indicated slot.
Device# show platform hardware slot 0 eobc interface primary status
EOBC interface status
EOBC : eth0, status : Active
Line State : Up, Speed : 1Gbps, Link mode : Full
Line Type : AUI, Autoneg : Disabled
Addr : 10.0.3.0, Netmask : 255.255.0.0, HW Addr : 0000.0300.0000
Rx pkts : 1292995, bytes : 316283357, dropped : 0 errors : 0
Tx pkts : 1124534, bytes : 270172949, dropped : 0 errors : 0
The table below describes the significant fields shown in the display.
Table 35 show platform hardware slot 0 eobc interface primary status Field Descriptions
Field
Description
EOBC: eth0
Ethernet port.
status
Port status. “Active” or “Standby.”
Line State
Line status. “Up” or “Down.”
Speed
Bandwidth in gigabits per second (Gbps).
Link mode
Transmission mode. “Full” (full duplex) or “Half” (half duplex).
Line Type
Type of transceiver. “AUI” (attachment unit interface), “TP” (twisted pair), “MII” (media independent interface), “FIBER” (fiber optic), or “BNC” (Bayonette Neil-Concelman).
Autoneg
Autonegotiation. “Enabled” or “Disabled.”
Addr
IP address of the port.
Netmask
IP addressing netmask of the port.
HW Addr
MAC address of the port.
Rx pkts/bytes
Number of packets and bytes received.
Tx pkts/bytes
Number of packets and bytes transmitted.
Rx dropped
Number of received packets that were dropped.
Tx dropped
Number of transmitted packets that were dropped.
Rx errors
Number of packets received with errors.
Tx errors
Number of packets transmitted with errors.
The following sample output from the show
platform hardware slot 0 eobc switch statistics brief command displays brief EOBC switch statistics for a SIP in chassis slot 0:
The table below describes the significant fields shown in the display.
Table 36 show platform hardware slot 0 eobc switch statistics brief Field Descriptions
Field
Description
Port
Port on the EOBC switch.
Link state
Link status. “Up” or “Down.”
Mode
Transmission mode. “Full Duplex” or “Half Duplex.”
Speed
Bandwidth in megabits per second (Mbps).
Ingress bytes
Number of bytes received on this port.
Egress bytes
Number of bytes transmitted through this port.
Ingress packets
Number of packets received on this port.
Egress packets
Number of packets transmitted through this port.
The following sample output from the show
platform hardware slot 0 fan status command displays fan operation status for a SIP in chassis slot 0:
Device# show platform hardware slot 0 fan status
Fan speed: 65%
Fan 0: Normal
Fan 1: Normal
Fan 2: Normal
The table below describes the significant fields shown in the display.
Table 37 show platform hardware slot 0 fan status Field Descriptions
Field
Description
Fan speed
Speed at which the fans are spinning as a percentage of their maximum speed.
Fan 0, 1, 2
Specifies whether a fan is encountering a fault condition. “Normal” or “Fail.”
The following sample output from the show
platform hardware slot 0 plim qos input bandwidth command displays the ingress arbiter settings for all PLIM buffers that are in use for a SIP in chassis slot 0:
The table below describes the significant fields shown in the display.
Table 38 show platform hardware slot 0 plim qos input bandwidth Field Descriptions
Field
Description
Ingress QOS Scheduling Mode
Current scheduler operation mode.
BW
Interface bandwidth in kilobits per second (kb/s).
Min BW
Guaranteed bandwidth assigned on this interface in Kbps.
Excessive Weight
Excessive bandwidth assigned on this interface in Kbps.
HP Policer BW
Bandwidth assigned for processing high-priority traffic on this interface in Kbps.
The following sample output from the show
platform hardware slot 0 plim statistics command displays PLIM statistics for a SIP in chassis slot 0. Interprocess communication (IPC) packets are internal control packets. The first set of RX and TX packet counts include both user packets and IPC packets. In this example, the RX/TX and RX IPC/TX IPC packet counts are the same because only IPC packets are being passed (no user packets).
The table below describes the significant fields shown in the display.
Table 39 show platform hardware slot 0 plim statistics Field Descriptions
Field
Description
RX Pkts
Packets (user data and IPC data) received by the PLIM from the indicated SPA.
TX Pkts
Packets (user data and IPC data) transmitted from the PLIM to the indicated SPA.
RX IPC Pkts
IPC packets received by the PLIM from the indicated SPA.
TX IPC Pkts
IPC packets transmitted from the PLIM to the indicated SPA.
The following is sample output from the show platform hardware slot f0 serdes statistics command for Cisco ASR1000-ESP20 and later versions of the ESP. This output displays the byte counters and packet counters associated with the Enhanced SerDes Interconnect (ESI) links for the ESP. The output includes information about drop counters and the number of link-level flow control messages. Information is displayed from the standpoint of the card (in this example, ESP0), where the command is run. An ESP displays information from all the cards with active ESI links connected to it. A SIP or an RP displays statistics from each ESP.
The following is sample output from the
show platform hardware slot f0 serdes statistics internal command for the Cisco ASR 1000-ESP10.
Device# show platform hardware slot f0 serdes statistics internal
Load for five secs: 35%/8%; one minute: 33%; five minutes: 30%
Time source is NTP, 12:20:00.746 IST Fri Nov 9 2011
Network-Processor Link:
Local TX in sync, Local RX in sync
From Network-Processor Packets: 1150522 Bytes: 166031138
To Network-Processor Packets: 4364008 Bytes: 697982854
RP/ESP Link:
Local TX in sync, Local RX in syncxist
Remote TX in sync, Remote RX in sync
To RP/ESP Packets: 1150522 Bytes: 166031138
Drops Packets: 0 Bytes: 0
From RP/ESP Packets: 4364008 Bytes: 697982854
Drops Packets: 0 Bytes: 0
Errors:
RX/TX process: 0/0, RX/TX schedule: 0/0
RX/TX statistics: 0/0, RX parity: 0
Encryption Processor Link:
Local TX in sync, Local RX in sync
Remote TX in sync, Remote RX in sync
The following is sample output from the
show platform hardware slot f0 serdes statistics internal command for the Cisco ASR 1000-ESP20 and later versions of the ESP.
Device# show platform hardware slot f0 serdes statistics internal
Load for five secs: 35%/8%; one minute: 33%; five minutes: 30%
Time source is NTP, 12:20:00.746 IST Fri Nov 9 2011
Network-Processor Link:
Local TX in sync, Local RX in sync
From Network-Processor Packets: 1150522 Bytes: 166031138
To Network-Processor Packets: 4364008 Bytes: 697982854
Encryption Processor Link:
Local TX in sync, Local RX in sync
Remote TX in sync, Remote RX in sync
The following sample output from the show platform hardware slot 0 spa oir-statistics command displays the OIR statistics of SPAs installed in a SIP in chassis slot 0:
The table below describes the significant fields shown in the display.
Table 41 show platform hardware slot 0 spa oir-statistics Field Descriptions
Field
Description
SPA OIR requests
Number of times the chassis software on the SIP made a request to the chassis software on the RP to allow a SPA to come online.
SPA OIR responses
Number of times the chassis software on the RP sent a response to an OIR request to the chassis software on the SIP.
SPA insertions
Number of SPA insertions since the last boot. The number is zero for SPAs that were in the chassis when the chassis booted.
SPA removals
Number of SPA removals since the last boot.
SPA driver starts
Number of times the SPA driver started.
SPA driver stops
Number of times the SPA driver stopped.
SPA driver deaths
Number of time the SPA driver reloaded.
The following sample output from the show platform hardware slot P0 mcu status displays the MCU hardware status and power supply in the slot:
If you use the
show platform hardware slotsipmcu status command or the
show platform
hardware slotsipfanstatus command on the Cisco ASR 1000 Series Router, we recommend that you use the value “Px” rather than “0” or other numeric values to specify the power supply slot. This command displays the MCU hardware status or fan status and references the power supply in the slot.
Device# show platform hardware slot P0 mcu status
Model ID: 5
12V I: 31
12V V: 11
Temp: 29
Input V: 218
Fan speed: 65%
The table below describes the significant fields shown in the display.
Table 42 show platform hardware slot mcu status Field Descriptions
Field
Description
Model ID
Model ID of the card slot.
12V
Power supply in the slot in voltage.
Temp
Chassis temperature.
Input V
Voltage input for power supply.
Fan speed
Speed at which the fans are spinning as a percentage of their maximum speed.
Related Commands
Command
Description
show platform hardware interface
Displays information about an interface.
show platform hardware port
Displays information about an interface port on an SPA.
show platform hardware subslot
Displays information about an SPA.
show platform hardware throughput level
To display the current maximum throughput level for a virtual router, use the show platform hardware throughput level command in Privileged EXEC mode.
showplatformhardwarethroughputlevel
Command Modes
Privileged EXEC
Command History
Release
Modification
Cisco IOS XE 3.9S
This command was introduced on the Cisco CSR 1000V Cloud Services Router.
Usage Guidelines
The maximum throughput level is determined by the installed license. Depending on the configuration and installed license, you can change the maximum throughput level. See the platform hardware throughput level command for more information.
Examples
The following example displays the maximum throughput level on the router:
Router# show platform hardware throughput level
The current throughput level is 50000 kb/s
Changes the maximum throughput level on the virtual router.
show platform hardware subslot
To display information about a Cisco ASR 1000 Series shared port adapter (SPA), use the
showplatformhardwaresubslotcommand in privileged EXEC or diagnostic mode.
Provides PLIM SPA settings (for Cisco Technical Support only).
statistics
Provides PLIM statistics.
internal
(Optional) Provides PLIM detailed statistics information (for Cisco Technical Support only).
Command Modes
Privileged EXEC (#) Diagnostic (diag)
Command History
Release
Modification
Cisco IOS XE Release 2.1
This command was introduced on the Cisco ASR 1000 Series Routers.
15.0(1)S
This command was modified. The minimum bandwidth and the proirity mode that cannot be configured in Strict Priority mode are not displayed in the output. The HP policer BW field was added to the output.
Examples
The following example displays ingress arbiter settings for all PLIM buffers that are in use for a SPA in chassis slot 1:
The table below describes the significant fields shown in the display.
Table 43 show platform hardware subslot 1/0 plim qos input bandwidth Field Descriptions
Field
Description
Ingress QOS Scheduling Mode
Current scheduler operation mode.
BW
Interface bandwidth in kilobits per second (kb/s).
Min Bw
Guaranteed bandwidth assigned on this interface in kb/s.
Excessive Weight
Excessive bandwidth assigned on this interface in kb/s.
HP Policer BW
Bandwidth assigned for processing high priority traffic on this interface in kb/s.
The following example displays PLIM statistics for a SPA in chassis slot 1. Interprocess communication (IPC) packets are internal control packets. The first set of RX and TX packet counts includes both user packets and IPC packets. In this example, the RX/TX and RX IPC/TX IPC packet counts are the same because no user packets are being passed, only IPC packets.
Specifies the port. If you do not select a port, this command will iterate through all ports.
Command Default
No default behavior or values
Command Modes
EXEC (#)
Command History
Release
Modification
12.2(33)SRD
This command was introduced on the Cisco 7600 series routers.
Note
This command applies only to the Cisco 7600 Series Ethernet Services Plus (ES+) line card on the Cisco 7600 series router.
Usage Guidelines
Use this command with the remote command command in EXEC mode.
Examples
The following example shows brief information for port 1.
Router# remote command module 13 show platform hardware transceiver brief 1
Show brief info for port 1:
GigabitEthernet13/1:
ID: SFP
Extended ID: 4
Xcvr Type: GE SX (13)
Connector: LC
Vendor name: CISCO-FINISAR
Vendor part number: FTLF8519P2BCL-CS
State: Enabled
The following example shows status information for port 1.
Router# remote command module 13 show platform hardware transceiver status 1
Show status info for port 1:
TenGigabitEthernet1/1:
State: Enabled
Environmental Information - raw values
Temperature: 7616
Tx voltage: 0 in units of 100uVolt
Tx bias: 28722 uA
Tx power: -2 dBm (5441 in units of 0.1 uW)
Rx power: 0 dBm (7712 in units of 0.1 uW)
(AUX1) Laser Temperature: 8704
(AUX2) +3.3V Supply Voltage: 32928
XFP TX is enabled.
XFP TX is soft enabled.
XFP is ready.
XFP is not power down.
XFP is not soft power down.
XFP doesn't have interrupt(s).
XFP is not LOS.
XFP data is ready.
XFP TX path is ready.
XFP TX laser is not in fault condition.
XFP TX path CDR is locked.
XFP RX path is ready.
XFP RX path CDR is locked.
No active alarms
No active warning
Related Commands
Command
Description
remote command {module num | standby-rp | switch} command
Executes a Cisco 7600 series router command directly on the switch console or a specified module without having to log into the Cisco 7600 series router first.
show platform isg memory
To display dynamically allocated memory usage information on the route processor (RP), use the
showplatformisgmemorycommand in privileged EXEC mode.
The table below describes the fields shown in the
showplatformisgmemorycommand display.
Table 45 show platform isg memory Field Descriptions
Field
Description
Allocator-Name
Name of the memory allocating process.
In-use
Indicates the current memory usage.
Allocated
Total memory allocated by the process.
Count
Number of allocated memory blocks.
show platform mgf
To show the details of the multi-gigabit fabric, use the
showplatformmgf command in privileged EXEC mode.
showplatformmgf
[ module | statisticscpu ]
Syntax Description
module
Shows details of the modules registered to the backplane switch manager (BPSM).
statistics
Displays the multi-gigabit fabric’s packet statistics.
cpu
Displays the multi-gigabit fabric’s cpu port statistics.
Command Default
None
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
15.0(1)M
This command was introduced for the Cisco 3900 Series, 2900 Series, and 1900 Series Integrated Services Routers (ISRs).
Usage Guidelines
To show the details of the multi-gigabit fabric, use the
showplatformmgf command in privileged EXEC mode. Or, enter the
showplatformmgf command and press Enter to display VLAN and slot assignments on the router. An asterisk next to the slot indicates that the vlan is the slot's default VLAN. The following example displays output from a Cisco 3945 ISR.
Note
Before Cisco IOS 15.1(3)T release, the Cisco Services Ready Engine (SRE) Service Module was managed by the platform backplane code. Therefore, when you entered the
show platform mgf
command, the Cisco SRE Service Module was displayed in the command output. But with Cisco IOS 15.1(3)T release, because the Cisco SRE Service Module is in the switchport managed module, it is no longer displayed in the
show platform mgf command output.
Note
VLAN1 is the default when no other VLAN are listed.
The following example displays the output for the
showplatformmgfmodule command when entered on a Cisco 3945 ISR. The table below displays the information code that appears in the output.
Router# show platform mgf module
Registered Module Information
Code: NR - Not Registered, TM - Trust Mode, SP - Scheduling Profile
BL - Buffer Level, TR - Traffic Rate, PT - Pause Threshold
slot vlan type/ID TM SP BL TR PT
---- ---- ---------- ------- --- ------ ----- ----
ISM NR
EHWIC-0 NR
EHWIC-1 NR
EHWIC-2 NR
EHWIC-3 NR
PVDM-0 NR
PVDM-1 NR
PVDM-2 NR
PVDM-3 NR
SM-1 1 SM/6 UP 1 high 1000 high
SM-2 1 SM/6 UP 1 high 1000 high
SM-3 NR
SM-4 NR
Table 46 Show Platform Backplane Module Information Code
Code
Description
NR
Not registered
TM
Trust mode
SP
Scheduling profile
BL
Buffer level
TR
Traffic rate
PT
Pause threshold
The following example displays output for the
showplatformmgfstatistics command when entered on a Cisco 1941 ISR.
The following example displays output for the
show platformmgfstatisticscpu command when entered on a Cisco 3945 ISR.
Router# show platform mgf statistics cpu
Backplane-GigabitEthernet0/3 is up, line protocol is up
Hardware is PQ3_TSEC, address is 001b.5428.d403 (bia 001b.5428.d403)
MTU 9600 bytes, BW 1000000 Kbit/sec, DLY 10 usec,
reliability 255/255, txload 1/255, rxload 1/255
Encapsulation ARPA, loopback not set
Full-duplex, 1000Mb/s, media type is internal
output flow-control is unsupported, input flow-control is unsupported
ARP type: ARPA, ARP Timeout 04:00:00
Last input never, output never, output hang never
Last clearing of "show interface" counters never
Input queue: 0/75/0/0 (size/max/drops/flushes); Total output drops: 0
Queueing strategy: fifo
Output queue: 0/40 (size/max)
5 minute input rate 0 bits/sec, 0 packets/sec
5 minute output rate 0 bits/sec, 0 packets/sec
0 packets input, 0 bytes, 0 no buffer
Received 0 broadcasts, 0 runts, 0 giants, 0 throttles
0 input errors, 0 CRC, 0 frame, 0 overrun, 0 ignored
0 watchdog, 0 multicast, 0 pause input
0 input packets with dribble condition detected
0 packets output, 0 bytes, 0 underruns
0 output errors, 0 collisions, 0 interface resets
0 unknown protocol drops
0 babbles, 0 late collision, 0 deferred
0 lost carrier, 0 no carrier, 0 pause output
0 output buffer failures, 0 output buffers swapped out Interface statistics for CPU: (port 0)
-----------------------------------------------------
30 second input rate 0 packets/sec
30 second output rate 0 packets/sec
0 packets input, 0 bytes, 0 overruns
Received 0 broadcasts, 0 multicast, 0 unicast 0 runts, 0 giants, 0 jabbers 0 input errors, 0 CRC, 0 fragments, 0 pause input 0 packets output, 0 bytes, 0 underruns 0 broadcast, 0 multicast, 0 unicast 0 late collisions, 0 collisions, 0 deferred 0 bad bytes received, 0 multiple, 0 pause output
Related Commands
Command
Description
showplatform
To display platform information, use the show platform command in privileged EXEC mode.
show platform slot r0 pcie status
To display information about all Peripheral Component Interconnect (PCI) buses on the Route Processor (RP) slot on the Cisco ASR 1000 Series Aggregation Services Router and devices connected to the PCI buses, use the
show platform slot r0 pcie status command in user EXEC or privileged EXEC mode.
show platform slot r0 pcie status
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC (#)
User EXEC (>)
Command History
Release
Modification
Cisco IOS XE Release 3.6
This command was introduced.
Examples
The following sample output from the
show platform slot r0 pcie status command displays information about all PCI buses on the RP slot on the Cisco ASR 1000 Series Aggregation Services Router and the devices connected to them:
Router# show platform slot r0 pcie status
00:00.0 Class 0600: Device 8086:65c0 (rev 90)
00:02.0 Class 0604: Device 8086:65f7 (rev 90)
00:03.0 Class 0604: Device 8086:65e3 (rev 90)
00:04.0 Class 0604: Device 8086:65e4 (rev 90)
00:05.0 Class 0604: Device 8086:65e5 (rev 90)
00:06.0 Class 0604: Device 8086:65e6 (rev 90)
00:07.0 Class 0604: Device 8086:65e7 (rev 90)
00:08.0 Class 0880: Device 8086:65ff (rev 90)
00:10.0 Class 0600: Device 8086:65f0 (rev 90)
00:10.1 Class 0600: Device 8086:65f0 (rev 90)
00:10.2 Class 0600: Device 8086:65f0 (rev 90)
00:11.0 Class 0600: Device 8086:65f1 (rev 90)
00:13.0 Class 0600: Device 8086:65f3 (rev 90)
00:15.0 Class 0600: Device 8086:65f5 (rev 90)
00:16.0 Class 0600: Device 8086:65f6 (rev 90)
00:19.0 Class 0200: Device 8086:10e5 (rev 02)
00:1a.0 Class 0c03: Device 8086:2937 (rev 02)
00:1a.1 Class 0c03: Device 8086:2938 (rev 02)
00:1a.2 Class 0c03: Device 8086:2939 (rev 02)
00:1a.7 Class 0c03: Device 8086:293c (rev 02)
00:1b.0 Class 0403: Device 8086:293e (rev 02)
00:1d.0 Class 0c03: Device 8086:2934 (rev 02)
00:1d.1 Class 0c03: Device 8086:2935 (rev 02)
The output fields are self-explanatory.
show platform software memory
To display memory information for the specified process, use the
showplatformsoftwarememorycommand in privileged EXEC or diagnostic mode.
The table below describes the significant fields shown in the
brief keyword display.
Table 48 show platform software memory brief Field Descriptions
Field
Description
module
Name of submodule.
allocated
Memory, allocated in bytes.
requested
Number of bytes requested by application.
allocs
Number of discrete allocation event attempts.
frees
Number of free events.
show platform software mount
To display the mounted file systems, both physical and virtual, for a Cisco ASR 1000 Series SPA Interface Processor (SIP), Cisco ASR 1000 Series Embedded Services Processor (ESP), or Cisco ASR 1000 Series Route Processor (RP), use the
showplatformsoftwaremountcommand in privileged EXEC or diagnostic mode.
showplatformsoftwaremount
[ slot [brief] ]
Syntax Description
slot
(Optional) Displays mounted file systems for the specified
slot. Possible
slot values are:
0--Cisco ASR 1000 Series SIP slot 0
1--Cisco ASR 1000 Series SIP slot 1
2--Cisco ASR 1000 Series SIP slot 2
f0--Cisco ASR 1000 Series ESP slot 0
f1--Cisco ASR 1000 Series ESP slot 1
fpactive--Active Cisco ASR 1000 Series ESP
fpstandby--Standby Cisco ASR 1000 Series ESP
r0--Cisco ASR 1000 Series RP slot 0
r1--Cisco ASR 1000 Series RP slot 1
rpactive--Active Cisco ASR 1000 Series RP
rpstandby--Standby Cisco ASR 1000 Series RP
brief
(Optional) Displays abbreviated mounted file system information.
Command Default
No default behavior or values.
Command Modes
Privileged EXEC (#)
Diagnostic (diag)
Command History
Release
Modification
Cisco IOS XE Release 2.1
This command was introduced on the Cisco ASR 1000 Series Routers.
Usage Guidelines
If no slot is specified, the command returns mounted file systems for the active RP.
This command allows you to ascertain the presence or absence of specific system mounts. For example, this command might be used to determine /tmp-related mounts, which are used to create many run-time directories and files.
Users may be requested to execute this command to collect information about the underlying configuration of the platform software.
The RP output can differ depending on how the router was booted, and whether there are USB devices inserted.
The SIP and ESP output can differ depending on whether the chassis is a dual or single RP.
Examples
The following example displays mounted file systems for the active RP:
The table below describes the significant fields shown in the SIP slot (0, 1, or 2) displays.
Table 49 show platform software mount SIP slot Field Descriptions
Field
Description
Filesystem
Logical name of the file system device.
Used
Number of 1Kb blocks used.
Available
Number of free 1Kb blocks available.
Use%
Percentage of 1Kb blocks used of the total available.
Mounted on
Canonical path to the mounted file system.
The following example displays abbreviated (brief keyword) mounted file system information for Cisco ASR 1000 Series SIP slot 0:
Router# show platform software mount 0 brief
Mount point: rootfs
Type : rootfs
Location : /
Options : rw
Mount point: proc
Type : proc
Location : /proc
Options : rw
Mount point: sysfs
Type : sysfs
Location : /sys
Options : rw
Mount point: none
Type : tmpfs
Location : /dev
Options : rw
Mount point: /dev/loop1
Type : iso9660
Location : /tmp/sw/cc/0/0/cc/mount
Options : ro
Mount point: none
Type : tmpfs
Location : /dev
Options : rw
Mount point: /proc/bus/usb
Type : usbfs
Location : /proc/bus/usb
Options : rw
Mount point: /dev/mtdblock1
Type : jffs2
Location : /obfl
Options : rw,noatime,nodiratime
Mount point: automount(pid3199)
Type : autofs
Location : /misc1
Options : rw,fd=5,pgrp=3199,timeout=60,minproto=2,maxproto=4,indirect
The tab le below describes the significant fields shown in the brief keyword display.
Table 50 show platform software mount brief Field Descriptions
Field
Description
Mount point:
Logical name of the file system device.
Type:
File system type.
Location:
Canonical path to the mounted file system.
Options:
Mount point type-specific flags and settings.
show platform software infrastructure punt-keepalive
To display information about the settings for the
platformpunt-keepalive command, use the
showplatformsoftwareinfrastructurepunt-keepalive command in the privileged EXEC mode.
showplatformsoftwareinfrastructurepunt-keepalive
Syntax Description
This command has no arguments or keywords.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 3.5S
This command was introduced.
Examples
The following is a sample output of the
showplatformsoftwareinfrastructurepunt-keepalive command when the punt-keepalive feature is enabled:
Router# show platform software infrastructure punt-keepalive
----- punt inject keepalive settings -----
punt keepalive interval (sec) = 2
punt keepalive warn count(miss) = 10
punt keepalive fatal (warn count) = 15
----- punt inject keepalive status -----
Last punt keepalive proc sched = 1.140 sec ago
Last punt keepalive sent = 1.140 sec ago
punt keepalive rx count = 1473
punt keepalive tx count = 1473
punt keepalive last keepalive received = yes
----- punt inject keepalive errors -----
punt keepalive failed to send no buffers = 0
punt keepalive tx fail count = 0
----- punt inject keepalive tweaks -----
ignore rx keepalive msg = no
ignore keepalive failover fault = yes
The following is a sample output of the
showplatformsoftwareinfrastructurepunt-keepalive command when the punt-keepalive feature is disabled:
Router# show platform software infrastructure punt-keepalive
----- punt inject keepalive settings -----
punt keepalive fatal (warn count) = 15
punt keepalive interval (sec) = 0(Stopped)
punt keepalive warning count (miss) = 10
Disable XE kernel core = No
----- punt inject keepalive status -----
Last punt keepalive proc sched = 8.005 sec ago
Last punt keepalive sent = 8.195 sec ago
punt keepalive rx count = 6695
punt keepalive tx count = 6695
punt keepalive last keepalive received = yes
----- punt inject keepalive errors -----
punt keepalive failed to send no buffers = 0
punt keepalive tx fail count = 0
Related Commands
Command
Description
platformpunt-keepalive
Enables the Punt-Keepalive feature and monitors the status of the punt path between the forwarding processor (FP) and the route processor (RP).
show platform software interface summary
To display a summary of statistics for interfaces that are configured on a networking device, use the
showplatformsoftwareinterfacesummary command in privileged EXEC mode.
(Optional) Displays, for the named interface, a summary of the packets held and dropped in input/output queues and the transmission/reception rates.
queues
(Optional) Displays a summary of the packets held and dropped in input/output queues, for interfaces on the router..
rates
(Optional) Displays a summary of the transmission/reception rates, for interfaces on the router.
Command Default
No default behavior or values.
Command Modes
Privileged EXEC (#)
Command History
Release
Modification
Cisco IOS XE Release 3.9
This command was introduced on Cisco 4400 Series Routers.
Usage Guidelines
Cisco ISR 4400 Series
On a Cisco ISR 4400 Series router you can use this command to show a summary of the packets held and dropped in input/output queues and the transmit/receive rates, for interfaces on the router.
Examples
The following example displays summary information for the interfaces of a Cisco 4400 Series router.
Displays running process information for the specified
slot. Possible
slot values are:
0--Cisco ASR 1000 Series SPA Interface Processor (SIP) slot 0
1--Cisco ASR 1000 Series SIP slot 1
2--Cisco ASR 1000 Series SIP slot 2
f0--Cisco ASR 1000 Series Embedded Services Processor (ESP) slot 0
f1--Cisco ASR 1000 Series ESP slot 1
fpactive--Active Cisco ASR 1000 Series ESP
fpstandby--Standby Cisco ASR 1000 Series ESP
r0--Cisco ASR 1000 Series Route Processor (RP) slot 0
r1--Cisco ASR 1000 Series RP slot 1
rpactive--Active Cisco ASR 1000 Series RP
rpstandby--Standby Cisco ASR 1000 Series RP
nameprocess-name
(Optional) Displays information for the specified process name.
process-id process-id
(Optional) Displays information for the specified process ID.
sortmemory
(Optional) Sorts the processes by memory.
summary
(Optional) Displays summary process information for the running host.
Command Default
No default behavior or values.
Command Modes
Privileged EXEC (#)
Diagnostic (diag)
Command History
Release
Modification
Cisco IOS XE Release 2.1
This command was introduced on the Cisco ASR 1000 Series Routers.
Usage Guidelines
The name and process-id keywords can be used to narrow the process list display down to specific processes.
The
sortkeyword can be used to sort the process list by memory size.
The summary keyword can be used to display summary information about running processes.
Examples
The following example displays information about running processes for Cisco ASR 1000 Series SIP slot 0:
Router# show platform software process list 0
Name Pid PPid Group Id Status Priority Size
------------------------------------------------------------------------------
init 1 0 1 S 20 1974272
ksoftirqd/0 2 1 1 S 39 0
events/0 3 1 1 S 15 0
khelper 4 1 1 S 15 0
kthread 5 1 1 S 15 0
kblockd/0 19 5 1 S 15 0
khubd 23 5 1 S 15 0
pdflush 59 5 1 S 20 0
pdflush 60 5 1 S 20 0
kswapd0 61 5 1 S 15 0
aio/0 62 5 1 S 15 0
xfslogd/0 63 5 1 S 15 0
xfsdatad/0 64 5 1 S 15 0
mtdblockd 626 1 1 S 20 0
loop0 1370 1 1 S 0 0
portmap 1404 1 1404 S 20 2076672
portmap 1406 1 1406 S 20 2076672
loop1 1440 1 1 S 0 0
udevd 2104 1 2104 S 16 1974272
jffs2_gcd_mtd1 2796 1 1 S 30 0
klogd 3093 1 3093 S 20 1728512
automount 3199 1 3199 S 20 2396160
xinetd 3214 1 3214 S 20 3026944
xinetd 3216 1 3216 S 20 3026944
pvp.sh 3540 1 3540 S 20 3678208
inotifywait 3575 3540 3575 S 20 1900544
pman.sh 3614 3540 3614 S 20 3571712
pman.sh 3714 3540 3714 S 20 3571712
btrace_rotate.s 3721 3614 3721 S 20 3133440
agetty 3822 1 3822 S 20 1720320
mcp_chvrf.sh 3823 1 3823 S 20 2990080
sntp 3824 1 3824 S 20 2625536
issu_switchover 3825 1 3825 S 20 3899392
xinetd 3827 3823 3823 S 20 3026944
cmcc 3862 3714 3862 S 20 26710016
pman.sh 3883 3540 3883 S 20 3571712
pman.sh 4014 3540 4014 S 20 3575808
hman 4020 3883 4020 R 20 19615744
imccd 4114 4014 4114 S 20 31539200
inotifywait 4196 3825 3825 S 20 1896448
pman.sh 4351 3540 4351 S 20 3575808
plogd 4492 4351 4492 S 20 22663168
inotifywait 4604 3721 4604 S 20 1900544
The table below describes the significant fields shown in the display.
Table 53 show platform software process list Field Descriptions
Field
Description
Name
Name of the process.
Pid
Process ID.
PPid
Parent Process ID.
Group Id
Process group ID.
Status
Process status.
Priority
Process priority.
Size
Virtual memory size (in bytes).
The following example displays information about a specific named process for Cisco ASR 1000 Series SIP slot 0:
Router# show platform software process list 0 name sleep
Name: sleep
Process id : 25938
Parent process id: 3891
Group id : 3891
Status : S
Session id : 3816
User time : 0
Kernel time : 0
Priority : 20
Virtual bytes : 2482176
Resident pages : 119
Resident limit : 4294967295
Minor page faults: 182
Major page faults: 0
The following example displays information about a specific process identifier for Cisco ASR 1000 Series SIP slot 0:
Router# show platform software process list 0 process-id 1
Name: init
Process id : 1
Parent process id: 0
Group id : 1
Status : S
Session id : 1
User time : 1
Kernel time : 741
Priority : 20
Virtual bytes : 1974272
Resident pages : 161
Resident limit : 4294967295
Minor page faults: 756
Major page faults: 0
The table below describes the significant fields shown in the
name and
process-idkeyworddisplays.
Table 54 show platform software process list name and process-id Field Descriptions
Field
Description
Name
Name of the process.
Process id
Process ID.
Parent process id
Parent process ID.
Group id
Process group ID.
Status
Process status.
Session id
Process session ID.
User time
Time (in seconds) spent in user mode.
Kernel time
Time (in seconds) spent in kernel mode.
Priority
Process priority.
Virtual bytes
Virtual memory size (in bytes).
Resident pages
Resident page size.
Resident limit
Current limit on Resident pages.
Minor page faults
Number of minor page faults.
Major page faults
Number of major page faults.
The following example displays process summary information for Cisco ASR 1000 Series SIP slot 0:
Router# show platform software process list 0 summary
Total number of processes: 54
Running : 4
Sleeping : 50
Disk sleeping : 0
Zombies : 0
Stopped : 0
Paging : 0
Up time : 1562
Idle time : 1511
User time : 1606
Kernel time : 1319
Virtual memory : 587894784
Pages resident : 45436
Major page faults: 25
Minor page faults: 149098
Architecture : ppc
Memory (kB)
Physical : 524288
Total : 479868
Used : 434948
Free : 44920
Active : 183020
Inactive : 163268
Inact-dirty : 0
Inact-clean : 0
Dirty : 0
AnonPages : 76380
Bounce : 0
Cached : 263764
Commit Limit : 239932
Committed As : 201452
High Total : 0
High Free : 0
Low Total : 479868
Low Free : 44920
Mapped : 59996
NFS Unstable : 0
Page Tables : 1524
Slab : 73760
VMmalloc Chunk : 426840
VMmalloc Total : 474856
VMmalloc Used : 47372
Writeback : 0
Swap (kB)
Total : 0
Used : 0
Free : 0
Cached : 0
Buffers (kB) : 6144
Load Average
1-Min : 0.00
5-Min : 0.00
15-Min : 0.00
The table below describes the significant fields shown in the
summary keyword display.
Table 55 show platform software process list summary Field Descriptions
Field
Description
Total number of processes
Total number of processes in all possible states.
Running
Number of processes in the running state.
Sleeping
Number of processes in the sleeping state.
Disk sleeping
Number of processes in the disk-sleeping state.
Zombies
Number of processes in the zombie state.
Stopped
Number of processes in the stopped state.
Paging
Number of processes in the paging state.
Up time
System Up time (in seconds).
Idle time
System Idle time (in seconds).
User time
System time (in seconds) spent in user mode.
Kernel time
System time (in seconds) spent in kernel mode.
Virtual memory
Virtual memory size (in bytes).
Pages resident
Resident page size.
Major page faults
Number of major page faults.
Minor page faults
Number of minor page faults.
Architecture
System CPU architecture: PowerPC (ppc).
Memory (kB)
System memory heading.
Physical
Total physical memory (in kilobytes).
Total
Total available memory (in kilobytes). This value represents the physical memory available for kernel use.
Used
Used memory (in kilobytes).
Free
Free memory (in kilobytes).
Active
Most recently used memory (in kilobytes).
Inactive
Memory (in kilobytes) that has been less recently used. It is more eligible to be reclaimed for other purposes.
Inact-dirty
Memory (in kilobytes) that may need to be written to persistent store (cache or disk).
Inact-clean
Memory (in kilobytes) that is readily available for re-use.
Dirty
Memory (in kilobytes) that is waiting to get written back to the disk.
AnonPages
Memory (in kilobytes) that is allocated when a process requests memory from the kernel via the malloc() system call. This memory has no file backing on disk.
Bounce
Memory (in kilobytes) that is allocated to bounce buffers.
Cached
Amount of physical RAM (in kilobytes) used as cache memory.
Commit Limit
Total amount of memory (in kilobytes) currently available to be allocated on the system. This limit is only adhered to if strict overcommit accounting is enabled.
Committed As
Total amount of memory (in kilobytes) presently allocated on the system. The committed memory is a sum of all of the memory that has been allocated by processes, even if it has not been used by them as of yet.
High Total
Total amount of memory (in kilobytes) that is not directly mapped into kernel space. The High Total value can vary based on the type of kernel used.
High Free
Amount of free memory (in kilobytes) that is not directly mapped into kernel space. The High Free value can vary based on the type of kernel used.
Low Total
Total amount of memory (in kilobytes) that is directly mapped into kernel space. The Low Total value can vary based on the type of kernel used.
Low Free
Amount of free memory (in kilobytes) that is directly mapped into kernel space. The Low Free value can vary based on the type of kernel used.
Mapped
Total amount of memory (in kilobytes) that has been used to map devices, files, or libraries using the mmap command.
NFS Unstable
Total amount of memory (in kilobytes) used for unstable NFS pages. Unstable NFS pages are pages that have been written into the page cache on the server, but have not yet been synchronized to disk.
Page Tables
Total amount of memory (in kilobytes) dedicated to the lowest page table level.
Slab
Total amount of memory (in kilobytes) used by the kernel to cache data structures for its own use.
VMalloc Chunk
Largest contiguous block of available virtual address space (in kilobytes) that is free.
VMalloc Total
Total amount of memory (in kilobytes) of total allocated virtual address space.
VMalloc Used
Total amount of memory (in kilobytes) of used virtual address space.
Writeback
Memory (in kilobytes) that is actively being written back to the disk.
Swap (kB)
Swap memory heading.
Total
Total swap memory (in kilobytes).
Used
Used swap memory (in kilobytes).
Free
Free swap memory (in kilobytes).
Cached
Cached swap memory (in kilobytes).
Buffers (kB)
Buffers heading.
Load Average
Indicators of system load.
1-Min
Average number of processes running for the last minute.
5-Min
Average number of processes running for the last 5 minutes.
15-Min
Average number of processes running for the last 15 minutes.
The following example displays process summary information for Cisco ASR 1000 Series sorted by memory size:
Router#show platform software process list R0 sort memory
Name Pid PPid Group Id Status Priority Size
------------------------------------------------------------------------------
linux_iosd-imag 27982 26696 27982 S 20 4294967295
fman_rp 25857 25309 25857 S 20 684867584
vman 30685 29587 30685 S 20 194850816
smand 30494 28948 30494 S 20 103538688
libvirtd 5260 5254 5254 S 20 83197952
python 10234 10233 10210 S 20 29765632
python 10975 10234 10975 S 20 29765632
python 10977 10234 10977 S 20 29765632
python 10978 10234 10978 S 20 29765632
python 10979 10234 10979 S 20 29765632
python 10981 10234 10981 S 20 29765632
automount 15682 1 15682 S 20 25092096
cmand 25530 24760 25530 S 20 23789568
imand 27198 26090 27198 S 20 22040576
psd 31284 28535 31284 S 20 16019456
emd 25712 24917 25712 S 20 15302656
hman 26622 25617 26622 R 20 14544896
plogd 28878 27718 28878 S 20 12349440
btrace_rotate.s 25251 24643 25251 S 20 6008832
sort_files_by_i 30092 29066 30092 S 20 5234688
periodic.sh 28469 27490 28469 S 20 4812800
rotee 5403 1 5396 S 20 4788224
rotee 5412 1 5411 S 20 4788224
rotee 5438 1 5437 S 20 4788224
rotee 5482 1 5481 S 20 4788224
rotee 9844 1 9843 S 20 4788224
rotee 9958 1 9957 S 20 4788224
rotee 16942 1 16941 S 20 4788224
rotee 16946 1 16945 S 20 4788224
rotee 24383 1 24382 S 20 4788224
rotee 24742 1 24741 S 20 4788224
rotee 24960 1 24959 S 20 4788224
rotee 25107 1 25106 S 20 4788224
rotee 25534 1 25533 S 20 4788224
rotee 25542 1 25541 S 20 4788224
rotee 25880 1 25879 S 20 4788224
rotee 26390 1 26389 S 20 4788224
rotee 26881 1 26880 S 20 4788224
rotee 27728 1 27727 S 20 4788224
rotee 27882 1 27881 S 20 4788224
rotee 28867 1 28866 S 20 4788224
rotee 29220 1 29219 S 20 4788224
rotee 29257 1 29256 S 20 4788224
rotee 29405 1 29404 S 20 4788224
rotee 29784 1 29783 S 20 4788224
oom.sh 5560 5246 5560 S 20 4427776
reflector.sh 15598 1 15598 S 20 3997696