Feedback
Table Of Contents
MGX 8800 Series Command Line Interface
MGX 8800 Series Command Line Interface
The preferred tools for configuring, monitoring, and controlling an MGX 8800 series switch are the CiscoView and Cisco WAN Manager (CWM) applications for equipment management and connection management, respectively. (The Cisco WAN Manager application is the former Cisco StrataView Plus application with the equipment management removed.) The command line interface (CLI) also provides access to an MGX 8800 series switch and is highly applicable during initial installation, troubleshooting, and any situation where low-level control is useful.
The MGX 8800 series commands in the tables that follow are divided by major functional group. Each table shows the complete name of the command and the cards for which the command is valid. For further reference, check the Installation and Configuration document for your specific switch type. The Installation and Configuration document provides conceptual information about how the Cisco MGX 8800 series switches can best implement network services in your network configuration. Examples of usage for the more common commands appear in the configuration chapters of this manual.
The command line prompt shows the name of the switch, the number of the switch (which is always "1"), the slot number and type for the current card, and whether the card is in the active ("a") or standby state ("s"). The following is an example of the command line prompt:
excel.1.6.AUSM.a >
In this case, the current card is an active AUSM in slot 6, and the name of the node is "excel."
The command notation and argument parameters follow standard programming convention: a space separates the command and each parameter; variables have an italicized typeface; required arguments appear within "<>" marks; optional parameters appear within square brackets ("[ ]"); and a vertical bar (|) represents the logical OR function.
Note
You must type all command arguments then press Return or Enter rather than enter one parameter at a time.
When you enter a command with no parameters, a usage message appears. This message shows syntax and ranges for the applicable command parameters.The list of commands for the common equipment cards PXM and SRM appear in . These commands are available when you log into the PXM. The Portable AutoRoute (PAR) commands appear in . Applicable service module commands become available when you switch to a card by executing the cc command. The list of service module commands appear in . Many commands apply to both the common equipment cards and the service modules.
?
Use the ? command to view all commands associated with the current card, and to view a list of commands associated with a truncated command entry.
Full Name
Help
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
? [command]
Syntax Description
Related Commands
help
Attributes
Log: No State: Any Privilege: Any UserExamples
This section contains the following examples:
•
•
Example 1-1 View all commands associated with a partial command entry string
raviraj.1.7.PXM.a > ? conAvailable commands------------------addconclrconcntclrconcntscnfcondcondbdelcondspcondspconcntdspconsshellConntstcontstconsegraviraj.1.7.PXM.a >Example 1-2 View all commands associated with the current card
System response for the ? command is identical to that when executing the help command. See the examples in the help section beginning on page 462.
abort
Use the abort command to stop the upgrade process and retun to the previous firmware version.
•
•
See to see the relationship of the abort command compared with other firmware commands.
Figure 1-1 Firmware-related Commands
Full Name
Abort
Card(s) on Which This Command Executes
PXM
Syntax
abort <version>
Syntax Description
A system response does not occur unless an error is detected.
Related Commands
dspupgrade, rstupgrade, newrev, dspfwrevs, printrev, commit, copy, install
Attributes
Log: No State: Active Privilege: Any UserExample 1-3 Abort loading firmware 1.1.10
NODENAME.1.7.PXM.a > abort 1.1.10this may take a while ...abort command completed okThis card will be reset, the other will become active.Example 1-4 Errors loading firmware (multiple cases)
NODENAME.1.8.PXM.a > abort 1.1.11cannot be in 'upgrade idle', must be in 'upgrade newrev' or 'upgradeinstall'ERR: command "abort" failedNODENAME.1.7.PXM.a > abort 1.1.111.1.11 is not the old version 1.1.10aaERR: command "abort" failedacqdsx3bert
Use the acqdsx3bert command to find out if a BERT session already exists on the selected
MGX 8800 series switch bay.Full Name
Acquire DS3 BERT
Card(s) on Which This Command Executes
FRSM 2CT3, CESMT3
Syntax
acqdsx3bert
Related Commands
cnfdsx3bert, dspdsx3bert, moddsx3bert, startdsx3bert, xcnfdsx3bert, xdspdsx3bert
Attributes
Log: No State: Active Privilege: Any UserExample 1-5 Acquire the current BERT session
NODENAME1.1.21.CESMT3.a > acqdsx3bertdspdsx3BertCntrs :BCRunning : 00BCStorage : 0BECRunning : 00BECStorage : 0DSX3 BERT in SyncNODENAME1.1.21.CESMT3.a >addapsln
Use the addapsln command to set Automatic Protection Switching (APS) on a specified line for the current PXM.
APS is a SONET switching mechanism that routes traffic from working lines to protect them in case of a line card failure or fiber cut.
To set APS parameters, use the cnfapsln command following the addapsln command.
Full Name
Add APS to a Line
Card(s) on Which This Command Executes
PXM
Syntax
addapsln <workline> <workslot> <protectline> <protectslot> <archmode>
Syntax Description
Related Commands
cnfapsln, delapsln, dspapsln, switchapsln
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-6 Add APS Protection line 1 on slot 8 to APS Working line1 on slot 7. Set the APS architect mode on the working/protection line pair to 1+1.
spirit4.1.8.PXM.a > addapsln 1 7 1 8 2spirit4.1.8.PXM.a >addaimgrp
Use the addaimgrp command to set an AIMUX group on the current AUSM.
Full Name
Add IMA Group
Card(s) on Which This Command Executes
AUSM
Syntax
addaimgrp <group_num> <port_type> <list_of_links> minNumLinks
Syntax Description
Related Commands
delaimgrp, cnfaimgrps, dspaimgrp, dspaimgrps
Attributes
Log: Yes State: Active Privilege: 1-2
Note
Example 1-7 Add IMA group 2 as UNI with lines 3, 4, and 5
spirit4.1.18.PXM.a > addaimgrp 2 3.4.5spirit4.1.18.PXM.a >A system response does not occur unless an error is detected.
addcdrscprtn
Use the addcdrscprtn command to set card-level resource partitions.
Note
The resource you can partition at the card level is the number of connections available to a network controller such as PAR.
With card-level partitioning:
•
•
describes the effects of each of three usages of addcdrscprtn.
In addition to the definitions in , note the following characteristics of this command:
•
•
•
Full Name
Add Card Resource Partition
Card(s) on Which This Command Executes
PXM, FRSM, CESM, VISM
Syntax: PXM
addcdrscprtn <ctrlr_num> <num_lcns>
Syntax Description
ctrlr_num
Value to set controller type.
•
•
•
num_lcns
Number of available GLCNs, in the range 0 - 32767.
Syntax: FRSM
addcdrscprtn <controller> <numOfLcnAvail>
Syntax Description
Syntax: CESM
addcdrscprtn <controller> <numOfLcnAvail>
Syntax Description
controller
Value to set controller type.
•
•
•
numOfLcnAvail
Maximum number of LCNs, in the range 0-248.
Related Commands
cnfcdrscprtn, dspcdrscprtn, delcdrscprtn, cnfcdrsctype
Example 1-8 On the current PXM, change the card-level partitioning to give 10000 GLCNs to PAR and 10000 GLCNs to Tag. Note that the value for PNNI currently is 0.
spirit4.1.8.PXM.a > addcdrscprtn 10000 0 10000spirit4.1.8.PXM.a >addchan
Use the addchan command to configure channels on the current PXM, FRSM, AUSM, or CESM. The syntax for using addchan on an AUSM differs from that used on all other cards. See page 1-Syntax: AUSM for guidelines.
Full Name
Add Channel
Card(s) on Which This Command Executes
PXM, FRSM (8T1/E1, HS1/B, VHS), AUSM, CESM
Related Commands
delchan, dspchan, dspchans
Attributes
Log: No State: Any Privilege: AnySyntax: PXM
addchan <LCN> <if_num> <conn_type> <vpi> <vci> <serv_type> <y_vpi> <y_vci> <y_nsap> <chan_master>
Syntax Description
Syntax: FRSM-8T1/E1
addchan <chan> <port> <dlci> <cir> <chan_type> [CAC] <mastership> <locnsap> <rmtvpi> <rmtvci> <rmtnsap>
Syntax Description
Syntax: FRSM-HS1/B
addchan <chan_num> <port_num> <dlci_num> <cir> <chan_type> [CAC] <mastership> <locnsap> <rmtvpi> <rmtvci> <rmtnsap>
Syntax Description
Syntax: FRSM-VHS
addchan <chan> <port> <dlci> <cir> <chan_type> <serv_type> [CAC_enable] <mastership> <locnsap> <rmtvpi> <rmtvci> <rmtnsap>
Syntax Description
Syntax: AUSM
addchan <channel number> <connection type> <port number> <vpi> <vci> <service type> <mastership> <locnsap> <rmtvpi> <rmtvci> <rmtnsap>
Syntax Description
Example 1-9 Add a VCC connection to channel 16 on port 1 with vpi=1, vci=1, ABR service type, and an egress queue number of 1
spirit4.1.18.AUSM.a > addchan 16 2 1 1 1 3 1 spirit4.1.18.AUSM.a >Syntax: CESM-8T1E1
addchan <chan_num> <port_num> <sig_type> <partial_fill> <cond_data> <cond_signalling> [mastership | locnsap | rmtvpi | rmtvci | rmtnsap]
Syntax Description
Syntax: CESM-T3E3
addchan <chan_num> <port_num> <cond_sig> <mastership> <locnsap> <rmtvpi> <rmtvci> <rmtnsap>
Syntax Description
Attributes
Log: Yes State: Active Privilege: 1-2addchanloop
Use the addchanloop command to configure a channel loopback to the current FRSM or AUSM card. This command causes the channel to loop at the Segmentation and Reassembly (SAR) stage.
Full Name
Add a Channel Loopback
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax: FRSM
addchanloop <chan_num>
Syntax Description
chan_num
Channel number to be used for the loopback on the current card.
•
–
–
–
–
Syntax for AUSM-8T1E1
addchanloop <port.VPI.VCI | ChanNum>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
ChanNum
Channel number, in the range 16-1015.
Related Commands
delchanloop, tstcon, tstdelay
Attributes
Log: Yes State: Active Privilege: 1-4Example 1-10 Adding channel loopback onto channel number 21
s1.1.12.AUSMB8.a > addchanloop 21
Example 1-11 Adding channel loopback onto port 2, VPI 1, VCI 1
s1.1.12.AUSMB8.a > addchanloop 2.1.1addcon
Use the addcon command to configure connectivity to the current card. The addcon command is preferable to addchan for adding a connection because addcon does not require the NSAP addresses.
Command execution includes a specification of the endpoint as either the master or the slave. Execute addcon first at the slave end, then the master end. Note the syntax for the master end includes a parameter SlaveConID. Rather than a single number, SlaveConID is the node name, slot number, port number, and connection identifier (if applicable) of the slave end.
Note
Full Name
Add Connection
Card(s) on Which This Command Executes
PXM, FRSM, CESM, AUSM
Related Commands
delcon, dspcons, dspcon
Attributes
Log: Yes State: Active Privilege: AnySyntax: PXM
addcon <port_no> <conn_type> <local_VPI> <local_VCI> <service> [CAC] [mastership] [remoteConnId]
Syntax Description
Syntax: FRSM-8T1/8E1
addcon <port number> <DLCI> <CIR> <channel type> [Adm_cntrl] <controller_type> <mastership> <RemoteEndConID>
Syntax Description
Syntax: FRSM-2CT3
addcon <port number> <DLCI> <CIR> <channel type> <egress service type> [Adm_cntrl] <controller_type> <mastership> <RemoteEndConID>
Syntax Description
Syntax: FRSM-2T3/2E3
addcon <port number> <DLCI> <CIR> <channel type> <egress service type> [Adm_cntrl] <controller_type> <mastership> <RemoteEndConID>
Syntax Description
Syntax: FRSM-HS2
addcon <port number> <DLCI> <CIR> <channel type> <egress service type> [Adm_cntrl] <controller_type> <mastership> <RemoteEndConID>
Syntax Description
Syntax: AUSM
addcon slave | master <port number> <vpi> <vci> <Conn type> <Service Type> [PAR | PNNI]
Syntax Description
Example 1-12 Add a VCC connection to channel 16 on port 2 with vpi=1, vci=1, ABR service type, and an egress queue number of 1
spirit4.1.18.AUSM.a > addcon 16 2 1 1 1 3 1 spirit4.1.18.AUSM.a >A system response does not occur unless an error is detected.
Syntax: CESM 8T1/E1
addcon <port number> <signalling type> <partial_fill> <cond_data> <cond_signalling> <controller_type> <mastership> <RemoteEndConID>]
Syntax Description
addendpt
Use the addendpt command to set the endpoints on the VISM card. An endpoint is a logical port that consists of one or more DS0s. It resembles the logical port on the channelized FRSM or CESM card. The ds1_num and the ds0_list are used to create the endpoint ID. The SU requires the endpoint ID to send the Create Connection (CRCX) command of the SGCP protocol to the VISM.
Full Name
Add End Point
Card(s) on Which This Command Executes
VISM
Syntax
addendpt <endpoint_num> <ds1_num> <ds0_list>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Active Privilege: AnyExample 1-13 Add endpoint number 1 to physical line 1. This endpoint uses DS0 1
spirit4.1.28.VISM.a > addendpt 1 1 1spirit4.1.28.VISM.a >A system response does not occur unless an error is detected.
addimagrp
Use the addimagrp command to configure an IMA group for the current AUSM.
Full Name
Add IMA Group
Card(s) on Which This Command Executes
AUSM
Syntax
addimagrp <group_num> <port_type> <list_of_links>
Syntax Description
Related Commands
dspimagrp, dspimagrpcnt, dspimagrps, dspimainfo, dspimalncnt
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-14 Add IMA group 2 as UNI with lines 3, 4, and 5
spirit4.1.88.AUSM.a > addimagrp 2 1 3.4.5 spirit4.1.88.AUSM.a >addlink
Use the addlink command to configure a link between a T1 line within a T3 line on a SRM-3T3 card and a slot and line number on a T1 service module.
Full Name
Add Link
Card(s) on Which This Command Executes
PXM
Syntax
addlink <T3 LineNum> <T1Slot> <Number of T1s> <TargetSlotNum> <TargetSlotLineNum> <T3LineNume>
Syntax Description
Related Commands
dsplink, dellink
Attributes
Log: No State: Active Privilege: AnyExample 1-15 Add a link between the T1 line 1 within T3 line 2 on the SRM-3T3 card in slot 15 and T1 line number 5 on the T1 service module in slot 3
spirit4.1.8.PXM.a > addlink 15.2 1 3 5spirit4.1.8.PXM.a >addlmiloop
Use the addlmiloop command to stop sending LMI connection status messages to the BPX feeder trunk. This command should be used in conjunction with addfdrlp on the BPX. This command can be used only if a feeder trunk exists.
After you have executed the addlmiloop command on the MGX 8800 series switch and the addfdrlp command on the BPX series switch, use the dsplmistats command on the BPX switch. The dsplmistats command shows the LMI messages exchanged between the BPX series switch and the MGX 8800 series switch. The LMI messages will not show an increase after LMI looping is implemented.
Figure 1-2 Status Messages Halted between a MGX 8800 Series Switch and a BPX Switch
Full Name
Add Line
Card(s) on Which This Command Executes
PXM
Syntax
addlmiloop <slot> <port>
Syntax Description
Related Commands
dellmiloop, dsplmiloop
Attributes
Log: No State: Active Privilege: 1Example 1-16 Add an LMI loopback line numbered 1 to the current card (the PXM in slot 8)
spirit4.1.8.PXM.a > addlmiloop 1 spirit4.1.8.PXM.a >Example 1-17 Add a feeder loop on the BPX
addfdrlp 5.5Example 1-18 Display LMI loop
spirit4.1.8.PXM.a > dsplmiloopTRK IN LMI LOOP-------------------1.8 YesExample 1-19 Display LMI statistics for the BPX; number of LMI messages in the statistics doesn't increase
VPI.VCI: 3.31 Lmi enabled Lmi polling enabledInvalid Pdu Rx: 0 Status Polling Timer (T396) : 10Invalid Pdu Len Rx: 14 Status Enquiry Timer (T393) : 10Unknown Pdu Type Rx: 0 Max Status Enquiry Retry (N394): 5Unknown IE Type Rx: 4 Update Status Timer (T394) : 10Bad Transaction Rx: 0 Max Update Status Retry (N395) : 5Status Rx: 46504 Spc Polling Timer : 2Status Enq Tx: 46546 Spc Retry Timer : 0Status Enq Rx: 92014 Spc Retry Counter : 1Status Tx: 92014 Node Status Retry Timer : 0Status Ack Rx: 185 Node Status Retry Counter : 0Update Status Tx: 297 Node Status Polling Timer : 8Update Status Rx: 203Status Ack Tx: 203VPI.VCI: 3.31 Lmi enabled Lmi polling enabledInvalid Pdu Rx: 0 Status Polling Timer (T396) : 10Invalid Pdu Len Rx: 14 Status Enquiry Timer (T393) : 10Unknown Pdu Type Rx: 0 Max Status Enquiry Retry (N394): 5Unknown IE Type Rx: 4 Update Status Timer (T394) : 10Bad Transaction Rx: 0 Max Update Status Retry (N395) : 5Status Rx: 46511 Spc Polling Timer : 0Status Enq Tx: 46553 Spc Retry Timer : 0Status Enq Rx: 92028 Spc Retry Counter : 1Status Tx: 92028 Node Status Retry Timer : 0Status Ack Rx: 185 Node Status Retry Counter : 0Update Status Tx: 297 Node Status Polling Timer : 9Update Status Rx: 203Status Ack Tx: 203addln
Use the addln command to activate an OC-12, OC-3, T3, or E3 line on the current card.
Full Name
Add Line
Card(s) on Which This Command Executes
PXM, FRSM-series, AUSM, SRM-3T3, CESM-series, VISM
Syntax: PXM
addln -ds3 <line number> | -e3 <line number> | -sonet <line number>
Syntax Description
Note
Syntax: FRSM (8T1, 2CT3, HS1/B), AUSM, SRM, CESM, VISM
addln <line_num>
Syntax Description
line_num
Line number, in the range appropriate for the interface.
•
•
•
Syntax: AUSM (8T1/E1, IMATM-T3T1/E3E1), SRM, CESM, VISM
addln <line_num>
Syntax Description
Related Commands
cnfln, delln, dspln
Attributes
Log: Yes State: Active Privilege: 1 (Any on PXM)Example 1-20 Add a line numbered 1 to the current card (the PXM in slot 8)
spirit4.1.8.PXM.a > addln 1
spirit4.1.8.PXM.a >addlnloop
Use the addlnloop command to set a specified line in loopback state on the current card.
Full Name
Add Line Loop
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Related Commands
dellnloop
Attributes
Log: Yes State: Active Privilege: Service (Any on PXM)Syntax: PXM
addlnloop <-ds3 | -e3 | -sonet> <line number>
Syntax Description
Syntax: FRSM, AUSM, CESM
addlnloop <line_num>
Syntax Description
addlns2aimgrp
Use the addlns2aimgrp command to add lines to an existing AIMUX group.
Full Name
Add Lines to an AIM Group
Card(s) on Which This Command Executes
AUSM
Syntax
addlns2aimgrp <grp_num> <list_of_lines>
Syntax Description
Related Commands
dellnsfmaimgrp
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-21 Add lines 1 and 2 to IMA group 2
spirit4.1.18.AUSM.a > addlns2aimgrp 2 1.spirit4.1.18.AUSM.a >addport
Use the addport command to add a service port to the shelf's configuration.
Full Name
Add a Port
Card(s) on Which This Command Executes
PXM, FRSM, CESM
Related Commands
addportlpbk, cnfport, delport, dspport, dspports
Attributes
Log: Yes State: Active Privilege: 1 (Any on PXM)Syntax: PXM OC-3
addport <port_number> <line_number> <percent_bandwidth> <min_vpi> <max_vpi>
Syntax Description
Syntax: PXM OC-12 back cards
addport <port_number> <line_number> <percent_bandwidth> <min_vpi> <max_vpi>
Syntax Description
Syntax: PXM T3/E3 back cards
addport <port_number> <line_number> <percent_bandwidth> <min_vpi> <max_vpi>
Syntax Description
Syntax: FRSM-8T1E1 cards
addport <port_num> <line_num> <ds0_speed> <begin_slot> <num_slot> <port_type>
Syntax Description
Syntax: FRSM-2T3E3 cards
addport <port_num> <line_num> <ds0_speed> <begin_slot> <num_slot> <port_type>
Syntax Description
Syntax: FRSM-2CT3
addport <port_num> <line_num> <ds0_speed> <begin_slot> <num_slot> <port_type>
Syntax Description
Syntax: FRSM-HS1/B
addport <port_num> <port_type>
Syntax Description
Syntax: FRSM-HS2
addport <port_num> <line_num> <ds0_speed> <begin_slot> <num_slot> <port_type>
Syntax Description
Syntax: CESM-8T1E1 cards
addport <port_num> <line_num> <ds0_speed> gin_slot> <num_slot> <port_type>
Syntax Description
Syntax: CESM-T3E3 cards
addport <port_num> <line_num>
Syntax Description
Example 1-22 Add port 1 on line 1 with DS0 timeslots 1 through 24 assigned as structured.
node501.1.1.CESM.a > addport 1 1 1 24 1node501.1.1.CESM.a >addred
Use the addred command to link two MGX 8800 series slots (a primary slot and a secondary slot) so that the switch treats the cards in these slots as a redundant pair of cards.
The secondary slot should be in the same half of the shelf (upper or lower) as the primary slot. Redundancy can be 1:1 or 1:N. If the redundancy is 1:N, you must link one secondary slot to N primary slots through multiple executions of this command.
Full Name
Add Redundancy
Card(s) on Which This Command Executes
PXM
Syntax
addred <redPrimarySlotNum> <redSecondarySlotNum> <RedType>
Syntax Description
Related Commands
dspred, delred
Attributes
Log: No State: Active Privilege: AnyExample 1-23 Add 1:1 redundancy between the card in slot 4 and the card in slot 1
node501.1.7.PXM.a > addred 1 4 1node501.1.7.PXM.a >A system response does not occur unless a system error is detected.
addrscprtn
Use the addrscprtn command to configure resource partitions for the current PXM.
A resource partition on a PXM consists of a percentage of bandwidth, a VPI/VCI range, and the number of global logical connection numbers (GLCNs) available to a network control application. The network control applications are Portable AutoRoute (PAR) and Tag Switching. The configuration should reflect future development plans for PNNI or other controllers.
Note
Full Name
Add Resource Partition
Card(s) on Which This Command Executes
PXM
Syntax
addrscprtn <if_num> <ctrlr_num> <ingr_pct_bw> <egr_pct_bw> <min_vpi> <max_vpi> <min_vci> <max_vci> <max_chans>
Syntax Description
Related Commands
cnfrscprtn, delrscprtn, dspifrsc, dspifs, dsprscprtns, dsprscprtn, dsplnrsc
Attributes
Log: No State: Any Privilege: Anyaddserialif
Use the addserialif command to add a serial interface.
Full Name
Add Serial Interface
Card(s) on Which This Command Executes
PXM
Syntax
addserialif <serial_port_num>
Syntax Description
Related Commands
cnfserialif, dspserialif
Attributes
Log: Yes State: Active Privilege: AnyExample 1-24 Configure the speed on slip for 19200bps
NODENAME.1.7.PXM.a > addserialif 1NODENAME.1.7.PXM.a >addtrapmgr
Use the addtrapmgr command to set up an SNMP trap manager for use with stand-alone applications. A trap manager registered (added) and reregistered through the SNMP interface by Cisco WAN Manager is deregistered (deleted) after 30 minutes if it is not reregistered. Trap managers that are added using the addtrapmgr command will not age, and will not be deleted after 30 minutes.
Full Name
Add Trap Manager
Card(s) on Which This Command Executes
PXM
Syntax
addtrapmgr <ipaddr> <portnum>
Syntax Description
Related Commands
deltrapmgr, cnftrapmgr, dsptrapmgr, xcnftrapmgr
Attributes
Log: Yes State: Active Privilege: AnyExample 1-25 Add a trap manager with the IP address of 161.10.144.56 to port 162
node501.1.7.PXM.a > addtrapmgr 161.10.144.56 162node501.1.7.PXM.a >addtrk
Use the PAR addtrk command to activate a specified trunk on the current PXM.
The addtrk command applies only to routing node implementation. Execute addtrk after you have partitioned resources for PAR by using addrscprtn and configured the broadband interface as a trunk by using cnfifastrk.
Note
Full Name
Add Trunk
Card(s) on Which This Command Executes
PXM
Syntax
addtrk <slot.port>
Syntax Description
slot.port
Port identifier of the trunk to activate, using the format slot.port.
•
•
Related Commands
cnftrk, dsptrkcnf, dsptrkload, dsptrks
Attributes
Log: No State: Active Privilege: 1Example 1-26 Activate the trunk on port 4 in the card in slot 1
node501.1.7.PXM.a > addtrk 1.4node501.1.7.PXM.a >adduser
Use the adduser command to configure a user name and associated access level on the PXM.
Full Name
Add User
Card(s) on Which This Command Executes
PXM
Syntax
adduser <user ID> <accessLevel>
Syntax Description
Related Commands
dspusers, deluser
Attributes
Log: Yes State: Active Privilege: 5-6Example 1-27 Add a user named fin with privilege level ANYUSER
spirit.1.7.PXM.a > adduser fin ANYUSEREnter password:Re-enter password:spirit.1.7.PXM.a >agetrapmgr
Use the agetrapmgr command to activate or deactivate aging on trap managers.
Full Name
Age Trap Manager
Card(s) on Which This Command Executes
PXM
Syntax
agetrapmgr <ip_addr> <aging>
Syntax Description
Related Commands
dsptrapmgr
Attributes
Log: No State: Any state Privilege: 1-6aimhelp
Use the aimhelp command to display the Help screen for the AUSM service module.
Full Name
AIM Help
Card(s) on Which This Command Executes
AUSM
Syntax
aimhelp
Related Commands
help
Attributes
Log: No State: Any state Privilege: 1-6Example 1-28 Display the Help screen for the AUSM service module
raviraj.1.9.AUSM8.a > aimhelpAUSM-8P Commandsaddcon : Add a Connectionaddimagrp : Add an IMA groupaddln : Add a lineaddlnloop : Configure a line in local loopbackaddlns2imagrp : Add lines to an existing IMA groupclralmcnt : Clear DS1 alarm countclralmcnts : Clear alarm count for all DS1 linesclralm : Clear the DS1 line alarmsclrchancnt : Clear Channel Countersclrchancnts : Clear Channel Counters for all channelsclralms : Clear DS1 alarms on all linesclrimagrpcnt : Clear IMA group Countersclrimalncnt : Clear IMA counters on a particular lineclrportcnt : Clear Port Countersclrportcnts : Clear Port Counters for all portsclrsarcnt : Clear SAR channel countersclrsarcnts : Clear SAR counters for all channelsclrslftst : Clear self test resultsclrimatst : clear IMA test procedureType <CR> to continue, Q<CR> to stop:cnfchanfst : Configure the channel foresight parameterscnfchanq : Configure the channel queue parameterscnffst : Configure foresight params of a cardcnfportq : Configure Egress queue parameterscnfimagrp : Configure an IMA groupcnfilmi : Configure ILMI parameters of a portcnfln : Configure DS1/E1 linecnflnloop : Configure DS1/E1 linecnfplpp : Configure DS1/E1 linecnfslftst : Configure self test parameterscnfsvcrange : Partition Resource between PVCs & SVCscnfupccbr : Configure UPC parameters of CBR connectioncnfupcvbr : Configure UPC parameters of VBR connectioncnfupcabr : Configure UPC parameters of ABR connectioncnfupcubr : Configure UPC parameters of UBR connectioncnfimatst : Enable the IMA test procedurecnfimaalmparm : COnfigure the IMA alaram Integration UP and DOWN timescopychans : Copy a template connectiondelimagrp : Delete an IMA groupType <CR> to continue, Q<CR> to stop:delcon : Delete a connectiondelln : Delete DS1 linedellnloop : Remove a DS1 line from local loopbackdellnsfmimagrp : Delete lines from an existing IMA groupdnport : Down an ATM portdspalm : Display DS1 alarms on a linedspalmcnf : Display DS1 alarm configurationdspalmcnt : Display alarm count for DS1 linedspalms : Display DS1 alarms on all linesdspcd : Display card informationdspchancnt : Display channel countersdspcon : Display connection configurationdspcons : Display all the configured connectionsdspfeature : Display the featuresdspfst : Display the card Foresight paramsdspilmi : Display ILMI parms of a portdspilmicnt : Display ILMI counters of a portdspimagrp : Display all parms configured for an IMA groupdspimagrpcnt : Display IMA group CountersType <CR> to continue, Q<CR> to stop:dspimagrps : Display the configured IMA groupsdspimalncnt : Display IMA counters on a particular linedspimatst : Display IMA test statusdspimaln : Display IMA link statusdspimaalmparm : Display IMA alaram integration timesdspln : Display DS1 linedsplns : Display all DS1 linesdsploads : Display the total bandwidth used up in each portdspplpp : Display the PLPP configuration of each linedspport : Display the configured ATM/IMA portdspportcnt : Display Port Countersdspportq : Display the egress queue configurationdspportqs : Display configuration of all egress queuesdspports : Display the configured ATM/IMA portsdspsarcnt : Display the SAR counters of a connectiondspsarcnts : Display the SAR counters of all connectionsdspslftst : Display self test configurationdspslftsttbl : Display the self test resultsdspsttatparms : Display the statistics params configuredType <CR> to continue, Q<CR> to stop:dspsvcrange : Display the resource partition between PVCs & SVCsdsptotals : Display the total connections configured per portrunslftstno : Run a particular self testtstcon : Test the connection towards the N/W sidetstconseg : Test the connection towards the CPE sidetstconsti : Test the connection towards the N/W side using STI supervisory celltstdelay : Measure the delay towards the N/W sidetstdelaysti : Measure the delay towards the N/W side using STI supervisory cellupport : Up an ATM portxcnfalm : Configure alms of a DS1 linexcnfln : Configure a DS1 linexcnfln : Configure a DS1 lineraviraj.1.9.AUSM8.a >arpAdd
Use the arpAdd command to add an Address Resolution Protocol (ARP) entry to the ARP table. This Internet protocol is used to map an IP address to a MAC address, and the ARP table contains these translations.
Full Name
Add Address Resolution Protocol Entry
Card(s) on Which This Command Executes
PXM
Syntax
arpAdd <ip_ddress> <mac_address>
Syntax Description
ip_addr
IP address in dotted decimal format.
mac_address
Standardized data link layer address, 6 bytes long. Also known as a hardware address, MAC-layer address, and physical address.
Related Commands
arpShow, arpDelete, arpFlush
Attributes
Log: No State: Any state Privilege: 1-6Example 1-29 Add an ARP entry on the current PXM, then show the ARP entry
NODENAME.1.7.PXM.a > arpAdd 172.29.36.102 0:e0:4f:5c:6c:5aNODENAME.1.7.PXM.a > arpShow172.29.36.28 at 8:0:20:a6:80:3b190.29.36.255 at 0:e0:4f:5c:6c:20172.29.36.102 at 0:e0:4f:5c:6c:5a171.71.54.104 at 0:e0:4f:5c:6c:20NODENAME.1.7.PXM.a >arpDelete
Use the arpDelete command to delete an entry in the Address Resolution Protocol (ARP) table. The ARP protocol is used to map an IP address to a MAC address, and the ARP table contains these translations.
Full Name
Delete Address Resolution Protocol Entry
Card(s) on Which This Command Executes
PXM
Syntax
arpDelete <ip_ddress>
Syntax Description
Related Commands
arpAdd, arpShow, arpFlush
Attributes
Log: No State: Any state Privilege: 1-6Example 1-30 Delete ARP entry for IP address 172.29.36.102
NODENAME.1.7.PXM.a> arpDelete 172.29.36.102172.29.36.102 (172.29.36.102) deletedNODENAME.1.7.PXM.a>arpFlush
Use the arpFlush command to remove non-permanent entries from the ARP table. The ARP protocol is used to map an IP address to a MAC address, and the ARP table contains these translations.
Full Name
Flush Address Resolution Protocol Table
Card(s) on Which This Command Executes
PXM
Syntax
arpFlush
Related Commands
arpAdd, arpDelete, arpShow
Attributes
Log: No State: Any state Privilege: 1-6Example 1-31 Flush the ARP table, then show the ARP table
NODENAME.1.7.PXM.a > arpFlushNODENAME.1.7.PXM.a > arpShow171.71.54.104 at 0:e0:4f:5c:6c:20NODENAME.1.7.PXM.a >arpShow
Use the arpShow command to display the Address Resolution Protocol (ARP) table. The ARP table contains IP address to MAC address translations mapped by the ARP protocol.
Full Name
Show Address Resolution Protocol Table
Card(s) on Which This Command Executes
PXM
Syntax
arpShow
Related Commands
arpAdd, arpDelete, arpFlush
Attributes
Log: No State: Any state Privilege: 1-6Example 1-32 Show the ARP table on the current PXM
NODENAME.1.7.PXM.a > arpShow190.29.36.255 at 0:e0:4f:5c:6c:20172.29.36.28 at 8:0:20:a6:80:3b171.71.54.104 at 0:e0:4f:5c:6c:20NODENAME.1.7.PXM.a >bootChange
Use the bootChange command to change to the boot IP address and gateway address of a PXM card. The IP address you define will be used only when the PXM is in boot state. Use the cnfifip command to assign IP addresses for the PXM and the shelf. Note that the bootChange values are sent and automatically updated on the standby card, and bootlines are synchronized.
The PXM tries to correct bad entries when it boots up. This information is copied to the standby card. If the bootChange IP address is different the shelf IP address, then it will bring the ethernet interface up on the standby with the bootChange IP address.
The shellconn version of this command updates only the local bootline values.
Note that several parameters are necessary for the network to function; specifically:
•
•
•
Note
If the CLI prompt is not there or if the switch is not enabled and in backup boot, you can use the usrEnetEnable command to bring up theEthernet interface.
Full Name
Boot Change
Card(s) on Which This Command Executes
PXM
Syntax
bootChange
Related Commands
cnfifip, usrEnetEnable
Attributes
Log: Yes State: Active Privilege: SERVICE_GPExample 1-33 Execute the bootChange on the current PXM
raviraj.1.7.PXM.a > bootChange'.' = clear field; '-' = go to previous field; ^D = quitboot device : lnPciprocessor number : 0host name :file name :inet on ethernet (e) : 172.29.37.41 : ffffff00inet on backplane (b):host inet (h) :gateway inet (g) : 172.29.37.1user (u) :ftp password (pw) (blank = use rsh):flags (f) : 0x0target name (tn) :startup script (s) :other (o) :raviraj.1.7.PXM.a >bye
Use the bye command to exit the current CLI shell.
Full Name
Bye
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, VISM
Syntax
bye
Related Commands
logout
Attributes
Log: Yes State: Any Privilege: AnyExample 1-34 Exit the current CLI shell.
spirit.1.8.PXM.a > bye(session ended)cc
Use the cc command to navigate from card to card on the shelf.
Full Name
Change Card
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
cc <slot number>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Any state Privilege: AnyExample 1-35 Switch from the AUSM in slot 22 to the PXM in slot 8
node1.1.22.AUSM8.a > cc 8(session redirected)node1.1.8.PXM.a >A system message does not occur unless an error is detected. If the card slot is empty, an error message is presented.
cd
Use the cd command to change the current directory on the PXM hard disk.
Full Name
Change Directory
Card(s) on Which This Command Executes
PXM
Syntax
cd <directory_name>
Syntax Description
Related Commands
ls, pwd, rename, rm/rmdir, deltree, copy
Attributes
Log: Yes State: Any Privilege: Group 3Example 1-36 Change directory to FW
raviraj.1.7.PXM.a > cd FWraviraj.1.7.PXM.a >Verify the current directory by using the pwd command.
Example 1-37 Return to the Root directory
raviraj.1.7.PXM.a > pwdC:FWraviraj.1.7.PXM.a > cd ..raviraj.1.7.PXM.a > pwdC:raviraj.1.7.PXM.a >clraimgrpcnt
Use the clraimgrpcnt command to clear all the AIMUX-related counters for all lines in the specified AIMUX group.
Full Name
Clear AIM Group Counters
Card(s) on Which This Command Executes
AUSM
Syntax
clraimgrpcnt <imagroup>
Syntax Description
imagroup
The number of the AIMUX group number on which you want to clear the AIMUX counters, in the range 1-8.
Related Commands
delaimgrpcnt
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-38 Clear all the AIM group counters in AIM group 8
node1.1.22.AUSM8.a > clraimgrpcnt 8node1.1.22.AUSM8.a >clraimlncnt
Use the clraimlncnt command to clear all the AIMUX line counters for the specified IMA group.
Full Name
Clear AIM (or Clear IMA) Line Counters
Card(s) on Which This Command Executes
AUSM
Syntax
clraimlncnt (or clrimalncnt) <imagroup> <linenum>
Syntax Description
imagroup
The number of the AIMUX group on which you want to clear the line counters associated with an IMA group, in the range 1-8.
linenum
Line number, in the range 1-8.
Related Commands
dspaimlncnt, clrimalncnt
Attributes
Log: No State: Active Privilege: 1
Example 1-39 Clear all the AIM line counters in AIM group 8
node1.1.22.AUSM8.a > clraimlncnt 8node1.1.22.AUSM8.a >clrallcnf
Use the clrallcnf command to clear all configuration elements for all the cards in the node. The system will query for confirmation before executing the clrallcnf command.
Warning
Full Name
Clear All Configurations
Card(s) on Which This Command Executes
PXM
Syntax
clrallcnf
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1-3Example 1-40 Clear Configuration Confirmation Query
node1.1.7.PXM.a > clrallcnfAll SM's config will be deleted, andthe shelf will be reset.Do you want to proceed (Yes/No)? No(command not executed)node1.1.7.PXM.a >clralm
Use the clralm command to clear alarms on a specified line on the current card. Alarms occurring after this command executes are not affected. If alarms on a line are cleared with this command, the results may be observable through the dspalm command.
This command can clear alarms caused by the collection of statistical data only. Alarms caused by network failure cannot be cleared. For example, an alarm caused by a collection of bipolar errors can be cleared, but an alarm caused by a card failure cannot.
Full Name
Clear Alarm
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax: PXM
clralm -ds3 <LineNum>
or
clralm -e3 <LineNum>
or
clralm -sonet <LineNum>
or
clralm -plcp <PLCPNUM>Syntax Description
Syntax: FRSM, AUSM, CESM, or VISM
clralm -ds1 <LineNum>
Syntax Description
LineNum
•
–
–
•
•
Syntax: SRM-3T3
clralm <-srmds3> <LineNum>
Syntax Description
Syntax: FRSM-HS1
clralm -hs1 <LineNum>
Syntax Description
Related Commands
clralms, dspalm, dspalms
Attributes
Log: No State: Any Privilege: 5-6Example 1-41 Clear all the alarms caused by the collection of statistical data for line 1 on the current card
node1.1.22.AUSM8.a > clralm -ds1 1node1.1.22.AUSM8.a >clralmcnt
Use the clralmcnt command to clear all the alarm counters and statistics on the specified line on the current card. All counters are reset to 0. The terminal does not display a response unless an error exists in the syntax.
Full Name
Clear Alarm Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax: PXM
clralmcnt -ds3 <LineNum>
clralmcnt -e3 <LineNum>
clralmcnt -sonet <LineNum>
clralmcnt -plcp <PLCPNUM>Syntax Description
Syntax: FRSM, AUSM, CESM, or VISM
clralmcnt -ds1 <LineNum>
Syntax Description
LineNum
Line number, in the range appropriate for the card.
•
•
•
Related Commands
dspalmcnt, clralmcnts
Attributes
Log: No State: Any Privilege: Any (5 on PXM)Example 1-42 Clear all the alarm counters and statistics collected for line 1 on the current card
node1.1.22.AUSM8.a > clralmcnt -ds1 1node1.1.22.AUSM8.a >clralmcnts
Use the clralmcnts command to clear all the alarm counters and statistics on the current card. All counters are reset to 0. The terminal does not display a response unless an error exists in the syntax.
Full Name
Clear All Alarm Counters/Statistics on the Current Card.
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Syntax
clralmcnts
Related Commands
dspalmcnt, clralmcnt
Attributes
Log: No State: Any Privilege: 1-5Example 1-43 Clear all the alarm counters and statistics collected for the current card
node1.1.22.AUSM8.a > clralmcntsnode1.1.22.AUSM8.a >clralms
The clralms command clears alarms on the current card. Alarms occurring after this command executes are not affected.
This command can clear alarms caused by the collection of statistical data only. Alarms caused by network failure cannot be cleared. For example, an alarm caused by a collection of bipolar errors can be cleared, but an alarm caused by a card failure cannot.
Full Name
Clear Alarms on Card
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Syntax: FRSM, AUSM,CESM, or VISM
clralms -ds1 <LineNum>
Syntax Description
LineNum
Line number on which to clear alarms, in the range 1-n, as appropriate for the physical installation.
Related Commands
clralm, dspalm, dspalms
Attributes
Log: No State: Any Privilege: 1-5Example 1-44 Clear all the alarms triggered by the collection of statistics for line 1 on the current card
node1.1.22.AUSM8.a > clralms -ds1 1node1.1.22.AUSM8.a >clratmlncnt
The clratmlncnt clears the ATM event counters for the specified line on the PXM.
Full Name
Clear All ATM Line Counters on the Specified Line Number
Card(s) on Which This Command Executes
PXM
Syntax
clratmlncnt <line_num>
Syntax Description
Related Commands
clratmlncnts
Attributes
Log: No State: Any Privilege: AnyExample 1-45 Clear all the ATM event counters for line 1 on the PXM
node1.1.7.PXM.a > clratmlncnt 1node1.1.7.PXM.a >clratmlncnts
Use the clratmlncnts command to remove all ATM counters on all the lines on the current card.
Full Name
Clear all ATM Line Counters on All Lines
Card(s) on Which This Command Executes
PXM
Syntax
clratmlncnts
Related Commands
clratmlncnt
Attributes
Log: No State: Any Privilege: AnyExample 1-46 Clear all the ATM event counters on the PXM
node1.1.7.PXM.a > clratmlncntsnode1.1.7.PXM.a >clrbertcntrs
Use the clrbertcntrs command to remove all counters associated with bit error rate testing.
Full Name
Clear BERT counters
Card(s) on Which This Command Executes
FRSM 2CT3, CESMT3
Syntax
clrbertcntrs
Related Commands
acqdsx3bert, cnfdsx3bert, deldsx3bert, dspdsx3bert, startdsx3bert, xcnfdsx3bert, xdspdsx3bert
Attributes
Log: No State: Any Privilege: AnyExample 1-47 Clear all BERT counters on the current FRSM
raviraj.1.13.VHS2CT3.a > dspdsx3bertundefined symbol: dspdsx3bertraviraj.1.13.VHS2CT3.a >clrcderrs
The clrcderrs command clears all card-related errors in an MGX 8800 series card. No response messages appear on screen. Refer to the dspcderrs description to see an example of the errors that this command clears, or execute the dspcderrs command before and after executing the clrcderrs command.
Full Name
Clear Hardware/Reset Errors in BRAM
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
clrcderrs
Related Commands
dspcderrs
Attributes
Log: No State: Any Privilege: SuperUserExample 1-48 Clear all the card-related errors on the FRSM in slot 4
node1.1.4.FRSM.a > clrcderrsnode1.1.4.FRSM.a >clrchancnt
Use the clrchancnt command to clear the channel counters for the specified channel on the current card. Counting resumes after the command executes.
The Frame Relay counters for each channel are
•
•
•
•
•
•
•
•
•
•
•
Full Name
Clear Channel Counters on a Specified Channel
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: PXM
clrchancnt -cnt <chanNum> -cc <clrButton>
Syntax Description
Syntax: FRSM
clrchancnt <chan_num>
Syntax Description
chan_num
Channel number, in the range appropriate for the card.
•
•
Syntax: AUSM
clrchancnt <Port.VPI.VCI | Chan_num>
Syntax Description
Port.VPI.VCI
Connection number, in the format port.VPI.VCI.
Chan_num
Channel number, in the range 16-1015.
Related Commands
dspchan, clrchancnts, dspchancnt
Attributes
Log: Yes State: Any Privilege: AnyExample 1-49 Clear all the channel counters for channel 16 on the FRSM in slot 4
node1.1.4.FRSM.a > clrchancnt 16node1.1.4.FRSM.a >clrchancnts
Use the clrchancnts command to clear all channel counters for all channels on the current service card. The counters resume accruing after the command executes. To view a list of the Frame Relay counters, refer to the description of clrchancnt.
Full Name
Clear All Channel Counters on the Card
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
clrchancnts
Related Commands
dspchan, clrchancnt, dspchancnt
Attributes
Log: Yes State: Any Privilege: 1-3 (Any on PXM)Example 1-50 Clear all the channel counters for all channels on the FRSM in slot 4
node1.1.4.FRSM.a > clrchancntsnode1.1.4.FRSM.a >clrconcnt
Use the clrconcnt command to clear the counters for the specified Connection Identifier on the current PXM card. Counting resumes after the command executes.
Full Name
Clear Connection Counters for a Specified Connection Identifier
Card(s) on Which This Command Executes
PXM
Syntax
clrconcnt <conn_ID>
Syntax Description
Related Commands
dspcon, clrconcnts, dspconcnt, dspconcnts
Attributes
Log: Yes State: Any Privilege: AnyExample 1-51 Clear all the counters for the connection on port 1 with a VPI of 2 and a VCI of 2
node4.1.8.PXM.a > clrconcnt 1.2.2node4.1.8.PXM.a >clrconcnts
Use the clrconcnts command to clear the counters for all the connections on the current PXM car. Counting resumes after the command executes.
Full Name
Clear Connection Counters for All Connections on the Card
Card(s) on Which This Command Executes
PXM
Syntax
clrconcnts
Related Commands
dspcon, clrconcnt, dspconcnt, dspconcnts
Attributes
Log: Yes State: Any Privilege: AnyExample 1-52 Clear all the counters for all the connections on the PXM card
node4.1.8.PXM.a > clrconcntsnode4.1.8.PXM.a >clrerr
Use the clrerr command to remove specified or all error log files. This command queries for confirmation prior to clearing the error log files from the system.
Full Name
Clear Error Log Counters for All Connections on the Card
Card(s) on Which This Command Executes
PXM
Syntax:
clrerr [-en <error slot>]
Syntax Description
-en
Command delineator that precedes the error slot entry.
error slot
Number of the log file to clear, which is identical to the slot number of the card.
Related Commands
dsperr
Attributes
Log: No State: Any Privilege: AnyExample 1-53 Clrerr query to proceed.
wilco.1.7.PXM.a > clrerrDo you want to proceed (Yes/No)? No(command not executed)wilco.1.7.PXM.a >clrifcnt
Use the clrifcnt command to clear the counters for a specified broadband interface.
Full Name
Clear Interface Counters for the Specified Interface
Card(s) on Which This Command Executes
PXM
Syntax
clrifcnt <if_num>
Syntax Description
Related Commands
clrifcnts
Attributes
Log: No State: Any Privilege: AnyExample 1-54 Clear the counters for the specified broadband interface (1)
wilco.1.7.PXM.a > clrifcnt 1ilco.1.7.PXM.a >clrifcnts
Use the clrifcnts command to clear the counters for all the broadband interfaces.
Full Name
Clear All Interface Counters
Card(s) on Which This Command Executes
PXM
Syntax
clrifcnts
Related Commands
clrifcnt
Attributes
Log: No State: Any Privilege: AnyExample 1-55 Clear the counters for all broadband interfaces on the PXM card
wilco.1.7.PXM.a > clrifcntswilco.1.7.PXM.a >clrimagrpcnt
Use the clrimagrpcnt command to clear Inverse Multiplexing ATM (IMA) group counters on the current AUSM card for a specified IMA group.
Full Name
Clear Inverse Multiplexing ATM Group Counters
Card(s) on Which This Command Executes
AUSM
Syntax
clrimagrpcnt (or clraimgrpcnt) <imagroup>
Syntax Description
Related Commands
dspimagrp, dspimagrpcnt, dspimagrps, dspimainfo, dspimalncnt
Attributes
Log: No State: Active Privilege: 1
Example 1-56 Clear all the inverse multiplexing ATM group counters for IMA group 1 on the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrimagrpcnt 1flyers01.1.17.AUSM.a >clrimalncnt
Use the clrimalncnt command to clear all AIMUX line counters for a specified line in an IMA trunk.
Full Name
Clear AIM (or Clear IMA) Line Counters
Card(s) on Which This Command Executes
AUSM
Syntax
clrimalncnt (or clraimlncnt) <imagroup> <linenum>
Syntax Description
Related Commands
dspaimlncnt, clraimlncnt
Attributes
Log: No State: Active Privilege: 1
Example 1-57 Clear all the inverse multiplexing ATM line counters for IMA group 1 on the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrimalncnt 1flyers01.1.17.AUSM.a >clrlmistats
Use the clrlmistats command to clear the Local Management Interface (LMI) related statistics on the current PXM.
Full Name
Clear All LMI Statistics
Card(s) on Which This Command Executes
PXM
Syntax
clrlmistats
Related Commands
dsplmistats
Attributes
Log: No State: Any Privilege: Any
Example 1-58 Clear the LMI statistics on the PXM card
penguin.1.7.PXM.a > clrlmistatsEnabled : 1 Port Status : 1VPI.VCI : 3.31Polling enable : 1T393 : 10 N394 : 5T394 : 10 N395 : 5WaitStatus : 0 WaitStAck : 0Retry Timer : 0 Retry Count : 1Poll Timer : 6 Trans Num : 86Status Rx : 0 Status Tx : 0UpdtStatus Rx : 0 UpdtStatus Tx : 0Status Enq Rx : 0 Status Enq Tx : 0Status Ack Rx : 0 Status Ack Tx : 0NodeStatus Rx : 0 NodeStatus Tx : 0NodeStaAck Rx : 0 NodeStaAck Tx : 0Bad PDU Rx : 0 Bad PDU Len Rx : 0Unknown PDU Rx : 0 Invalid I.E. Rx: 0Invalid Trans : 0BPX IP Addr : 172.3.3.62penguin.1.7.PXM.a >clrlog
Use the clrlog command to clear specified or all event log files. The log resumes accumulating event log messages after the command executes. This command queries for confirmation prior to removing all event log files.
Full Name
Clear Log
Card(s) on Which This Command Executes
PXM
Syntax
clrlog [-log <log slot>]
Syntax Description
-log
Command delineator that precedes the log slot entry.
log slot
Number of the file that you want to clear from the event log file.
Related Commands
dsplog
Attributes
Log: Yes State: Any Privilege: 1
Example 1-59 Clear all event log files on the PXM card
wilco.1.7.PXM.a > clrlogDo you want to proceed (Yes/No)? Yeswilco.1.7.PXM.a >clrmsgcnt
Use the clrmsgcnt command to clear the control message counters. The control message counters are for the total numbers of:
•
•
•
equal to riscRcvCtrlMsg)•
equal to riscXmtCtrlMsg)•
•
•
This message also clears the control cell header received on the last unknown channel.
Full Name
Clear Control Message Counters
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Syntax
clrmsgcnt
Related Commands
dspmsgcnt
Attributes
Log: No State: Any Privilege: 1-5
Example 1-60 Clear all the control message counters on the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrmsgcnt 1flyers01.1.17.AUSM.a >clrportcnt
Use the clrportcnt command to clear counter values on a specified port associated with the current PXM, AUSM, or FRSM.
Full Name
Clear Port Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM
Syntax
clrportcnt <port_ number>
Syntax Description
port_ number
Port number, as appropriate for the current card.
•
•
•
–
–
–
X.21 range = 1-4
HSSI range = 1-2
Related Commands
clrportcnts, dspportcnt
Attributes
Log: No State: Any Privilege: 1-5 (Any on PXM)
Example 1-61 Clear all the port counters on port 1 on the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrportcnt 1flyers01.1.17.AUSM.a >clrportcnts
Use the clrportcnts command to clear all port counters on the current PXM, FRSM, or AUSM.
Full Name
Clear Port Counts
Card(s) on Which This Command Executes
PXM, FRSM, AUSM
Syntax
clrportcnts
Related Commands
clrportcnt, dspportcnt
Attributes
Log: No State: Any Privilege: 1-5
Example 1-62 Clear all the port counters on all the ports on the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrportcntsflyers01.1.17.AUSM.a >clrsarcnt
On an FRSM or CESM, use the clrsarcnt command to clear the Segmentation and Reassembly (SAR) counters for the particular channel in the argument. On an AUSM, use the clrsarcnt command to clear the SAR counters for the particular port.VPI.VCI connection.
The SAR counters are
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
Full Name
Clear SAR Counters
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Syntax for FRSM-8T1E1
clrsarcnt -chn <ChanNum | Port.DLCI>
Syntax Description
Syntax for CESM-8T1E1
clrsarcnt -chn <ChanNum>
Syntax Description
Syntax for AUSM-8T1E1
clrsarcnt <port.VPI.VCI>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
Related Commands
dspsarcnt
Attributes
Log: No State: Any Privilege: 1-5
Example 1-63 Clear the SAR counters for channel number 20 on the FRSM card
NODENAME.1.17.FRSM.a > clrsarcnt -chn 20NODENAME.1.17.FRSM.a >clrsarcnts
Use the clrsarcnts command to clear the Segmentation and Reassembly (SAR) counters for all the channels or connections on the card from which the command is executed.
Full Name
Clear SAR Counts
Syntax
clrsarcnts
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Related Commands
clrsarcnt, dspsarcnt, dspsarcnts
Attributes
Log: No State: Any Privilege: Any
Example 1-64 Clear all the SAR counters on all the cards in the node
flyers01.1.17.AUSM.a > clrsarcntsflyers01.1.17.AUSM.a >clrscrn
Use the clrscrn command to clear the control terminal screen. After this command executes, only the current command line prompt appears on the screen.
Full Name
Clear Terminal Screen
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
clrscrn
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample 1-65 Clear the screen
flyers01.1.17.AUSM.a > clrscrnflyers01.1.17.AUSM.a >clrslftst
Use the clrslftst command to clear the results of the last self-test on the current card.
Full Name
Clear Self-Test
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
clrslftst
Related Commands
cnfslftst, dspslftst, runslftstno
Attributes
Log: No State: Any Privilege: AnyExample 1-66 Clear the results of the last self-test for the AUSM card in slot 17
flyers01.1.17.AUSM.a > clrslftstflyers01.1.17.AUSM.a >clrsmcnf
Use the clrsmcnf command to clear the following configuration elements for the selected service card:
•
•
•
•
Note
Full Name
Clear Service Module Configuration
Card(s) on Which This Command Executes
PXM
Syntax
clrsmcnf <slot number>
Syntax Description
Related Commands
dspsmcnf
Attributes
Log: Yes State: Active Privilege: 3Example 1-67 Clear all the configuration elements on the AUSM card in slot 17
flyers01.1.7.PXM.a > clrsmcnf 17flyers01.1.7.PXM.a >clrsrmcnf
Use the clrsrmcnf command to clear SRM-3T3 card information and to remove all T1 link mappings. All links are switched back to their respective service modules.
Full Name
Clear SRM-3T3 Configuration
Card(s) on Which This Command Executes
PXM
Syntax
clrsrmcnf <slot number>
Syntax Description
slot number
Slot number. Enter the value 15 or 31.
•
•
Related Commands
addlink, dsplink, xcnfsrmlink, xdspsrmlink
Attributes
Log: Yes State: Active Privilege: AnyExample 1-68 Clear all the configuration information and remove all T1 link mappings on the SRM-3T3 card in slot 15
flyers01.1.7.PXM.a > clrsrmcnf 15flyers01.1.7.PXM.a >cmdhistory
Use the cmdhistory command to view the last 10 commands executed on the current card.
Full Name
Display Command History
Card(s) on Which This Command Executes
PXM
Syntax
cmdhistory
Related Commands
history
Attributes
Log: No State: Any Privilege: AnyExample 1-69 Display the previous 10 commands executed on the PXM card
spirit4.1.8.PXM.a > cmdhistorySize of cmdHistory is currently 10 line(s)1 dspconcnt 2.39.452 dsplmistats3 dsplmiloop4 dsplm5 clrportcnt6 dspportcnts7 dspportcnt8 dspportcnt 19 dsplmistats10 cmdhistoryspirit4.1.8.PXM.a >cnfaimgrp
Use the cnfaimgrp command to configure an AIMUX group on the AUSM.
Full Name
Configure AIM Group
Card(s) on Which This Command Executes
AUSM
Syntax
cnfaimgrp <grp> <max_diff_delay> <min_num_links>
Syntax Description
Related Commands
addaimgrp, delaimgrp, dspaimgrp, dspaimgrps
Attributes
Log: Yes State: Active Privilege: 1-2
Note
The <read_wr_ptr_diff> value cannot be decreased from its existing value—it can only be increased (this is because decreasing the <read_wr_ptr_diff> in an established AIMUX group involves dropping cells that are stored in the delay compensation buffer.Example 1-70 Configure AIMUX group 1 on the AUSM card in slot 17 to have a read/write pointer differential of 5, a link loss severity of 2, a maximum tolerable differential delay of 5, and 2 redundant links
flyers01.1.17.AUSM.a > cnfaimgrp 1 -rwdiff 5 -severity 2 -maxdiff 3 -red 2flyers01.1.17.AUSM.a >cnfapsln
Use the cnfapsln command to set Automatic Protection Switching (APS) parameters for a line on the current PXM. APS is a standard that provides a means for SONET line redundancy. APS involves switching between working (active) and protection (standby) SONET lines in the event of a hardware failure detected by the receiving end or by the far-end. This support only applies to PXM OC3 and PXM OC12 back cards.
The 1.1.20 software release provides support for the SONET Linear APS 1+1 mode with two backcards. The SONET Linear APS 1+1 standard specifies that for every working line there must exist a redundant protection line. Traffic protected by the redundant line is carried simultaneously on both the working line and the protection line. The line switch over to the protection line has to be completed within 60ms.
illustrates a "Dual Backcard" redundancy configuration. This design requires two PXM front cards and two SONET backcards. Ports are paired as follows:
•
Figure 1-3 SONET APS 1+1 with Two BACKCARDS
SONET 155 also can be configured to have this redundancy configuration. Ports are paired as follows:
•
•
•
•
Switching of the paired port on the pair backcard can be done independently of the other paired ports.
You must add an APS line with the addapsln command before using the cnfapsln command.
Full Name
Configure APS Line
Card(s) on Which This Command Executes
PXM
Syntax
cnfapsln <workline> <SFBER> <SDBER> <WTR> <Direction> <Revertive> <K1K2>
Syntax Description
Related Commands
addapsln, delapsln, dspapsln, dspapscfg
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-71 Configure the APS working line 1 on the active PXM card in slot 7 to have a signal failure BER threshold of 10^^5, a signal degrade BER threshold of 10^^5, to enable switch back after signal failure or degradation has cleared, to wait 2 minutes before attempting to switch back, to make switching bidirectional, and to enable the K1/K2 inband interface on the protection line
flyers01.1.7.PXM.a > cnfapsln 1 5 5 1 2 1 1flyers01.1.7.PXM.a >cnfatmln
Use the cnfatmln command to configure a UNI or NNI cell header for a PXM trunk. UNI cell headers are typically used on the line that connects to a workstation rather than a switch.
Note
Full Name
Configure ATM Line
Card(s) on Which This Command Executes
PXM (in an MGX 8800 series stand-alone node)
Syntax
cnfatmln <line_num> <type>
Syntax Description
Related Commands
dspatmlncnf, clratmlncnt
Attributes
Log: No State: Any Privilege: AnyExample 1-72 Set the cell header type for trunk 1 on the PXM to NNI
flyers01.1.7.PXM.a > cnfatmln 1 3flyers01.1.7.PXM.a >cnfbctype
Use the cnfbctype command to specify the interface of the 12in1 dual-personality back card. The back card can be configured with either an X.21 or a V.35 interface. The default interface is V.35.
Note
Full Name
Configure Back Card Type
Card(s) on Which This Command Executes
FRSM-HS1B
Syntax
cnfbctype <cardType>
Syntax Description
Related Commands
dspbctype
Attributes
Log: Yes State: Any Privilege: Service Group (-1)Example 1-73 Configuring the interface type on the current FRSM card
man.1.14.FRSM.a > cnfbctype 1Example 1-74 Displaying the interface type on the current FRSM
man.1.14.FRSM.a > dspbctypeBackcard Personality: X.21cnfbert
Use the cnfbert command to configure BERT testing parameters on the PXM.
A BERT session does not time out automatically. Use the delbert command to end the test.
Warning
BERT is a disruptive test. Activation of this test will stop the data flow on all the channels configured on the port under test. BERT testing requires the presence of an SRM-3T3/B card in the service bay, in which the card under test is located.
Full Name
Configure BERT
Card(s) on Which This Command Executes
PXM
Syntax: PXM
cnfbert <slot>
Syntax Description
Related Commands
delbert, dspbert, modbert, xcnfbert
Attributes
Log: Yes State: Active Privilege: Group 1cnfcbclk
Use the cnfcbclk command to set the cell bus (CB) operating clock rate to high (42 MHz) or low
(21 MHz). There are 8 cell buses in a MGX 8800 series shelf. You can use the cnfcbclk command to set the cell bus to different operating clock rates to take advantage of high-speed service modules whenever possible. Note that not all service modules can support the high clock rate.
Note
Full Name
Configure Cell Bus Clock
Card(s) on Which This Command Executes
FRSM_2CT3, FRSM_2T3, FRSM_2E3, FRSM_HS2, CESM_T3, CESM_E3, VISM_8T1, VISM_8E1, RPM (new), PXM
Syntax
cnfcbclk <cellBus> <clockRate>
Syntax Description
Possible Errors
•
•
Related Commands
dspcbclk
Attributes
Log: Yes State: Active Privilege: Super GroupExample 1-75 Display the cards in the chassis, display the current clock settings, configure CB2 for 42 MHz, and display clock settings with the new setting for CB2
NODENAME12.1.7.PXM.a > dspcdsCommand Executed :dspcdsSlot CardState CardType CardAlarm Redundancy---- ----------- -------- --------- -----------1.1 Empty Clear1.2 Active FRSM-8T1 Clear1.3 Empty Clear1.4 Empty Clear1.5 Empty Clear1.6 Active FRSM-8T1 Clear1.7 Active PXM1-OC3 Clear1.8 Empty Clear1.9 Empty Clear1.10 Empty Clear1.11 Empty Clear1.12 Empty Clear1.13 Empty Clear1.14 Empty Clear1.15 Empty Clear1.16 Empty Clear1.17 Empty Clear1.18 Empty Clear1.19 Empty ClearType <CR> to continue, Q<CR> to stop: qNODENAME12.1.7.PXM.a > dspcbclkCommand Executed :dspcbclkCellBus Rate (MHz) Slot-------------------------------CB1 21 1, 2CB2 21 3, 4CB3 21 5, 6CB4 21 17 - 22CB5 21 9, 10CB6 21 11, 12CB7 21 13, 14CB8 21 25 - 30NODENAME12.1.7.PXM.a > cnfcbclk cb2 42Command Executed :cnfcbclkNODENAME12.1.7.PXM.a > dspcbclkCommand Executed :dspcbclkCellBus Rate (MHz) Slot-------------------------------CB1 21 1, 2CB2 42 3, 4CB3 21 5, 6CB4 21 17 - 22CB5 21 9, 10CB6 21 11, 12CB7 21 13, 14CB8 21 25 - 30Example 1-76 Error messages that may be displayed when executing this command
popeye12.1.7.PXM.a > cnfcbclk cb1 42Command Executed :cnfcbclkSet failed due to illegal option value(s)Syntax: cnfcbclk <cellBus> <clockRate>cellBus -- a string CB1..CB8clockRate -- a number 21 or 42 (MHz)WARNING: Certain Service Modules will not operate at the clock rate youspecified. Please check the Service Modules in the slots where the Cell Bus clockrate is effected by this commandcnfcdprtntype
Use the cnfcdprtntype command to configure the type of partition to serve as the basis for sharing GLCNs. The GLCNs are shared by the network controller applications (PAR, for example) on a logical broadband interface.
Full Name
Configure Card Resource Type
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
cnfcdprtntype <prtn_type>
Syntax Description
Related Commands
cnfrscprt, cnfcdrscprtn, dspcdrsctype
Attributes
Log: No State: Any Privilege: Any (Service_GP)Example 1-77 Allow all controllers access to all the (G)LCNs available for the card
spirit3.1.10.AUSMB8.a > cnfcdprtntype 1spirit3.1.10.AUSMB8.a >cnfcdrscprtn
Use the cnfcdrscprtn command to modify card-level resource partitions on the current card. This command creates a template of available connections among the network controllers, to provide card-level partitioning for PAR, PNNI or Tag. With card-level partitioning:
•
•
The matrix in describes the effects of each of three usages of cnfcdrscprtn.
Table 1-5 Degrees of Card-Level Resource Partitioning
Note
Additional characteristics of this command are
•
•
Full Name
Configure Card Resource Partition
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
cnfcdrscprtn <PAR_max_conns> <PNNI_max_conns> <Tag_max_conns>
Syntax Description
Related Commands
addcdrscprtn, delcdrscprtn, dspcdrscprtn, dspcdrsctype
Attributes
Log: Yes State: Any (Active for PXM) Privilege: AnyExample 1-78 On the current PXM, change the card-level partitioning to give 10000 GLCNs to PAR and 10000 GLCNs to Tag. Note that the value for PNNI currently is 0
spirit.1.7.PXM.a > cnfcdrscprtn 10000 0 10000spirit.1.7.PXM.a >cnfchan
Use the cnfchan command to configure channels on the current service card.
Full Name
Configure Channel
Card(s) on Which the Command Executes
PXM, AUSM, CESM
Syntax: PXM
cnfchan <LCN> <chan_rte_pri> <chan_max_cost> <chan_restrict_trk_type>
Syntax Description
Syntax: AUSM-8T1E1
cnfchan <chan_num> <RoutingPriority> <MaxCost> <RestrictTrunkType> <PCR> <MCR> <PctUtil>
Syntax Description
Syntax: CESM-8T1E1
cnfchan <chan_num> <CDVT> <CLIP> <bufsize> <clockmode> <ISenable> <ForceIS>
Syntax Description
Syntax: CESM-T3E3
cnfchan <chan_num> <CDVT> <CLIP> <bufsize>
Syntax Description
Related Commands
addchan
Attributes
Log: No State: Any Privilege: Any
Example 1-79 On the current AUSM in slot 17, change the configuration for channel 16 to set a routing priority of 1, a maximum cost of 5, restrict trunk routing for this channel to terrestrial trunks only, set the peak cell rate to 655525 cells per second, set the minimum cell rate to 655525 cells per second, and set the percent utilization to 100 percent
spirit.1.17.AUSM.a > cnfchan 16 1 5 2 65525 65525 100spirit.1.17.AUSM.a >cnfchaneir
Use the cnfchaneir command to configure the frame relay policing parameter "excess information rate" (EIR), which is the second bucket leak rate for a channel. No messages appear on the screen unless an error occurs.
Available
Release 1.1.21 and higher
Full Name
Configure channel EIR
Card(s) on Which the Command Executes
FRSM-8T1/E1, FRSM-VHS
Syntax: PXM
cnfchaneir <chan_num> <zerocireir>
Syntax Description
Related Commands
dspchan
Attributes
Log: Yes State: Active Privilege: 1-2
cnfchancacoff
Use the cnfchancacoff command to turn off the connection admission control (CAC) function for a channel.
Full Name
Configure Channel CAC Off
Card(s) on Which This Command Executes
FRSM
Syntax
cnfchancacoff <chan_num>
Syntax Description
chan_num
Channel number, in the range appropriate for the interface type.
•
•
•
•
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1-2
Example 1-80 On the current FRSM in slot 27, change the configuration for channel 16 to turn off the connection admission control (CAC) function
spirit.1.27.FRSM.a > cnfchancacoff 16spirit.1.27.FRSM.a >cnfchanegressq
Use the cnfchanegressq command to configure the egress queue for a specified channel.
Full Name
Configure Channel Egress Queue
Card(s) on Which This Command Executes
FRSM
Syntax
cnfchanegressq <chan_num> <Qsel> <Qdepth> <QDEThresh> <QECNThresh>
Syntax Description
Related Commands
cnfchaningressq
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-81 On the current FRSM in slot 27, change the configuration of the egress queue for channel 16 to set the priority to high, set the maximum queue depth to 65535, the Discard Eligible threshold to 32767, and the ECN threshold to 65535
spirit.1.27.FRSM.a > cnfchanegressq 16 1 65535 32767 65535spirit.1.27.FRSM.a >cnfchanfst
Use the cnfchanfst command to configure ForeSight parameters for a Frame Relay or ATM channel.
Full Name
Configure Channel ForeSight
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax: FRSM
cnfchanfst <chan_num> <fst_enable> <mir> <pir> <qir>
Syntax Description
Syntax: AUSM
cnfchanfst <port.VPI.VCI | channel number> <enable | disable> <fgcra_enable> <ibs> <pcr> <mcr> <icr>
Syntax Description
Related Commands
dspchan
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-82 On the current FRSM in slot 27, change the configuration of the ForeSight for channel 16 to enable ForeSight, to set the minimum information rate to 1000 cells per second, to set the peak information rate to 1000 cells per second, and to set the quiescent information rate to 1000 cells per second
spirit.1.27.FRSM.a > cnfchanfst 16 1 1000 1000 1000spirit.1.27.FRSM.a >A system response does not occur unless an error is detected.
Example 1-83 On the current AUSM in slot 12, changing the configuration using the port.VPI.VCI argument
s1.1.12.AUSM8.a > cnfchanfst 2.1.5 2 1 2000 4000 2000 2000s1.1.12.AUSM8.a >Example 1-84 On the current AUSM in slot 12, changing the configuration using the channel number argument
s1.1.12.AUSM8.a > cnfchanfst 31 2 1 2000 4000 2000 2000s1.1.12.AUSM8.a >
Note
cnfchaningressq
Use the cnfchaningressq command to configure the Ingress queue for a specified channel.
Full Name
Configure Channel Ingress Queue
Card(s) on Which This Command Executes
FRSM
Syntax
cnfchaningressq <chan_num> <Qsel> <Qdepth> <QDEThresh> <QECNThresh>
Syntax Description
Related Commands
cnfchanegressq
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-85 On the current FRSM in slot 27, change the configuration of the egress queue for channel 16 to set the priority to high, set the maximum queue depth to 65535, the Discard Eligible threshold to 32767, and the ECN threshold to 65535
spirit.1.27.FRSM.a > cnfchaningressq 16 1 65535 32767 65535spirit.1.27.FRSM.a >cnfchanmap
Use the cnfchanmap command to configure interworking field mapping for a specified channel.
Full Name
Configure Channel Map
Card(s) on Which This Command Executes
FRSM
Syntax
cnfchanmap <chan_num> <chanType> <FECN/EFCI> <DE to CLP> <CLP to DE>
Syntax Description
Related Commands
dspchanmap
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-86 On the current FRSM in slot 27, change the configuration of the interworking channel mapping for channel 16 to set the channel type to network interworking, to set EFCI equal to 0, to set the DE to CLP mapping to map DE to CLP, and to set the CLP to DE mapping to map CLP to DE
spirit.1.27.FRSM.a > cnfchanmap 16 1 1 1spirit.1.27.FRSM.a >cnfchanpol
Use the cnfchanpol command to configure the Frame Relay policing parameters for a channel. No messages appear on screen unless an error occurs.
Full Name
Configure Channel Policing
Card(s) on Which This Command Executes
FRSM
Syntax
cnfchanpol <chan_num> <cir> <bc> <be> <ibs> <detag>
Syntax Description
Related Commands
dspchan
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-87 On the current FRSM in slot 27, change the configuration of the ForeSight for channel 16 to enable ForeSight, to set the committed information rate to 100000 cells per second, to set the committed burst size to 65535 bytes, to set the burst excess to 65535 bytes, to set the initial burst size to 1000 bytes, and to enable Discard Eligible tagging
spirit.1.27.FRSM.a > cnfchanpol 16 1 100000 65535 65535 1000 1spirit.1.27.FRSM.a >cnfchanq
Use the cnfchanq command configure queue parameters for a specified channel on the current PXM or AUSM.
Full Name
Configure Channel Queue
Card(s) on Which This Command Executes
PXM, AUSM
Syntax: PXM
cnfchanq <LCN> <discard_option> <clp_thresh_high> <clp_thresh_low> <efci_thresh>
Syntax Description
Syntax: AUSM
cnfchanq <chan_num> <vc_q_depth> <clp_thresh_high> <clp_thresh_low> <efci_thresh>
Syntax Description
Related Commands
dspchan
Attributes
Log: Yes State: Active Privilege: 1-2 on AUSM, Any on PXMExample 1-88 On the current AUSM in slot 1, change the configuration of the channel queue for channel 16 to set the ingress queue depth to 16000, the CLP High threshold to 16000, the CLP Low threshold to 10000, and the EFCI threshold to 12000
spirit.1.1.AUSM.a > cnfchanq 16 16000 16000 10000 12000spirit.1.1.AUSM.a >cnfchansrvrate
Use the cnfchansrvrate command to provision the service rate of a channel independent of the CIR rate of the connection. This feature separates the policing parameters (CIR, BC, BE, IBS) from the service rate, providing you with more traffic management control over the connection.
Full Name
Configure Channel Service Rate
Card(s) on Which This Command Executes
FRSM 2T3/E3, FRSM HS2, FRSM-8
Syntax
cnfchansrvrate <LCN> <ena | dis> <srvrate>
Syntax Description
Related Commands
cnfchanfst
Attributes
Log: Yes State: Any state Privilege: AnyExample 1-89 Configure the SAR on the current FRSM, service connection 16, at 4000 cells per second, even though the CIR for the connection may be set to 0
NODENAME.1.26.VHS2CT3.a > cnfchansrvrate 16 1 4000NODENAME.1.26.VHS2CT3.a >cnfclksrc
Use the cnfclksrc command to configure an interface as a clock source. Available clock sources are shown in . Any combination of clock sources are configurable in any order (primary or secondary). For example, you can configure an external clock source as the primary clock source and a line as the secondary clock source. If the primary and secondary clock sources fail, than the internal oscillator becomes the source.
Before using the cnfclksrc command, the PXM1 broadband interfaces and the service module lines must be configured. Therefore, you would first need to run the addln command, then the addport command.Configure only one clock source each time you execute cnfclksrc, and run the command from the active PXM1.
Table 1-6
Clock Sources
Full Name
Configure Clock Source
Card(s) on Which This Command Executes
PXM, FRSM, CESM. AUSM
Syntax: PXM, FRSM, CESM, AUSM
cnfclksrc <slot.port> <clktype>
Syntax Description
Related Commands
dspclksrc, dspclkinfo, cnfextclk
Attributes
Log: No State: Active Privilege: 1Example 1-90 Configure the inband (trunk) interface as the primary clock source and an external clock device as the secondary source
spirit.1.8.PXM.a > cnfclksrc 7.1 Pspirit1r.1.8.PXM.a > cnfclksrc 7.35 Scnfcon
Use the cnfcon command to configure connectivity parameters on the PXM, AUSM, FRSM, or CESM. The applicable parameters were previously specified by the addcon command.
Full Name
Configure Connection
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: PXM
cnfcon <conn_ID> <route_priority> <max_cost> <restrict_trunk_type> [CAC]
Syntax Description
Syntax: FRSM, AUSM
cnfcon <Port.Dlci> <chan_type> <cir> [CAC]
Syntax Description
Syntax: CESM
cnfcon <port_num> <CDVT> <CLIP> <bufsize> <clockmode> <IdleSuppression> <ForceSuppression>
Syntax Description
Related Commands
addcon, dspcon, dspcons, delcon
Attributes
Log: Yes State: Active Privilege: AnyExample 1-91 Configures the connection on port 1 with a VCI of 2 and a VPI of 5 to use routing priority 15, a maximum routing cost of 255, to not use satellite trunks, and to enable connection admission control
spirit01.1.7.PXM.a > cnfcon 1.2.5 15 255 3 2spirit01.1.7.PXM.a >cnfdate
Use the cnfdate command to set the system date.
Full Name
Configure Date
Card(s) on Which This Command Executes
PXM
Syntax
cnfdate <mm/dd/yyyy>
Syntax Description
mm/dd/yyyy
Month, day, year
•
•
•
Related Commands
None
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-92 Set date to be 11/24/1999
excel.1.3.PXM.a > cnfdate 11/24/1999Date = 11/24/1999excel.1.3.PXM.a >cnfdsx3bert
Use the cnfdsx3bert command to specify a pattern for BERT testing on the FRSM.
Full Name
Configure DS3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax
cnfdsx3bert <test pattern>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-93 Set the double alternating ones-and-zeroes pattern for the BERT
popeye1.1.21.CESMT3.a > cnfdsx3bert 4popeye1.1.21.CESMT3.a >cnfegrservtype
Use the cnfegrservtype command to change the Egress port servicing algorithm. Egress port queue servicing type is a card level option. You can choose either four-queue, Weighted Fair Queuing (WFQ) algorithm with quality of service guaranteed, or simple ratio-based, two-queue algorithm without quality of service.
Software Version
Command available with 1.1.20 and higher
Full Name
Configure Egress Servicing Type
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
cnfegrservtype <servicing type>
Syntax Description
servicing type
A value representing one of the following servicing types:
•
•
Related Commands
dspegrservtype
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-94 Configure Egress service type to queue ratio
raviraj.1.10.VHS2CT3.a > cnfegrservtype "99"The card will be reset, Do you want to proceed (Yes/No)? YesErr: card reset/removed/failed on slot 10slot 2 (cardInx 3) is present, insertion msg from PXM 7cnfextclk
Use the cnfextclk command to configure the line type and impedance of the external clocking source.
Full Name
Configure External Clocking
Card(s) on Which This Command Executes
PXM
Syntax
cnfextclk <ClockType> <Impedance>
Syntax Description
Related Commands
dspextclk
Attributes
Log: Yes State: Active Privilege: Group3Example 1-95 Configure the clocking to be extracted from an E1 line with an impedance of
100 ohmsexcel.1.3.PXM.a > cnfextclk 2 2excel.1.3.PXM.a >cnfenetgw
Use the cnfenetgw command to establish the Ethernet gateway route permanently.
Software Version
Command available with 1.1.20 and higher
Full Name
Configure Ethernet Gateway
Card(s) on Which This Command Executes
PXM
Syntax
cnfenetgw <IPaddress>
Syntax Description
Related Commands
dspenetgw
Attributes
Log: No State: Active Privilege: Super GroupExample 1-96 Configures the gateway 172.29.37.1 and adds the necessary routes
excel.1.3.PXM.a > cnfenetgw 172.28.37.1excel.1.3.PXM.a >cnffst
Use the cnffst command to configure ForeSight parameters for the current card.
Full Name
Configure ForeSight
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
cnffst <rate_up> <rate_down> <rate-fast_down> <qir_time_out> <rtd_interval>
Syntax Description
Related Commands
dspfst
Attributes
Log: Yes State: Active Privilege: 1-2cnfif
Use the cnfif command to modify parameters for an existing broadband interface on a PXM. System software does not allow you to conflict with existing configurations. You may need to reduce the bandwidth allocation or VPI/VCI range on one or more interfaces before you expand the resources for a interface. Refer to the upif command description for more information on resource partitioning.
Full Name
Configure a Broadband Interface
Card(s) on Which This Command Executes
PXM
Syntax
cnfif <if_num> <pct_bw> <min_vpi> <max_vpi>
Syntax Description
Related Commands
upif
Attributes
Log: No State: Any Privilege: AnyExample 1-97 Configure broadband interface number 1 to use 10% of the line bandwidth for both ingress and egress, have a minimum virtual path interface (VPI) of 0, and a maximum virtual path interface (VPI) of 19
wilco.1.7.PXM.a > cnfif 1 10 0 19wilco.1.7.PXM.a >Example 1-98 Confirm configuration for the broadband interface
wilco.1.7.PXM.a > dspififNum Status Line ingrPctBw egrPctBw minVpi maxVpi------------------------------------------------------1 Ena 1 10 10 0 19wilco.1.7.PXM.a >cnfifastrk
Use the cnfifastrk PAR command to configure a logical interface on the PXM to act as a feeder trunk. The application for this command is dependent upon the activation of the paid feature option of feeder capability on the MGX 8800 series switch node. Before configuring the interface as a feeder trunk the option must be activated with the cnfswfunc command. Therefore, the default is "rtrk" for routing trunk. The routing trunk utilization applies to both a routing node and a stand-alone node.
Full Name
Configure Interface as Trunk
Card(s) on Which This Command Executes
PXM
Syntax
cnfifastrk <slot.port> <iftype>
Syntax Description
Related Commands
uncnfifastrk
Attributes
Log: No State: Active Privilege: 2Example 1-99 Configure line 1 on the PXM in slot 7 as a feeder trunk
wilco.1.7.PXM.a > cnfifastrk 7.1 ftrkwilco.1.7.PXM.a >cnfifip
Use the cnfifip command to configure the interface address for LAN, SLIP, or ATM on the PXM. In addition, you can specify an interface to be up or down dynamically. No reboot is required to bring an interface up or down, and interfaces set to "down" are persistant across resets.
A shelf now can have one or two IP addresses for Ethernet. The shelf IP address set using the cnfifip command will always be the IP address of the active card.
The bootChange IP address is used for the standby card and backup boot if it is different from the shelf IP address. If the bootChange IP address is same as the shelf IP address, then the Ethernet interface on the standby card or in backup boot is left in the down state.
Software Version
New feature (up/down IP interface) available with 1.1.20 and higher
Full Name
Configure Interface Address
Card(s) on Which This Command Executes
PXM
Syntax
cnfifip <Interface> [[<IP_Addr> <Net_Mask> <BroadcastAddr>] | InterfaceFlag]
Syntax Description
Related Commands
dspifip
Attributes
Log: Yes State: Active only Privilege: Super GroupExample 1-100 Configure the ATM interface and bring it up
wilco.1.7.PXM.a > cnfifip atm 192.9.200.1 255.255.255.128wilco.1.7.PXM.a >A system response does not occur unless an error is detected. To confirm your configuration for the interface address, use the dspifip command.
Example 1-101 Configure the ATM interface with the current information in the database
wilco.1.7.PXM.a > cnfifip atm upwilco.1.7.PXM.a >Example 1-102 Remove the ATM interface and preserve the information in the database
wilco.1.7.PXM.a > cnfifip atm downwilco.1.7.PXM.a >cnfilmi
Use the cnfilmi command to configure the local management interface port on the PXM or AUSM. A system response does not occur unless an error is detected.
Full Name
Configure ILMI
Card(s) on Which This Command Executes
PXM, AUSM
Syntax: PXM
cnfilmi <ifNum> <bbIfSigPortNum> <ilmiEnable> <sigProtocolType> <signallingVPI> <siganllingVCI> <iLMITrap> <minTrapInterval> <keepAlive> <errorThresholdN491> <pollingIntervaalT491> <eventThresholdN492> <minEnquiryIntervalT493> <addrRegEnable>
Syntax Description
Syntax: AUSM
cnfilmi <port_num> <signal_type> <vpi> <vci> <scr> <trap_enable> <min_trap_int> <keep_alive>
Syntax Description
Related Commands
dspilmi, dspilmicnt
Attributes
Log: Yes State: Active Privilege: 1 (Cisco for PXM)cnfimagrp
Use the cnfimagrp command to configure delay and resilient links Inverse Multiplexing ATM (IMA) parameters on the current AUSM card.
Full Name
Configure IMA Group
Card(s) on Which This Command Executes
AUSM
Syntax
cnfimagrp <grp> <max_diff_delay> <min_num_links>
Syntax Description
Related Commands
dspimagrp, dspimagrps, dspimagrpcnt
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-103 Configure AIMUX group 1 on the AUSM card in slot 17 to have a read/write pointer differential of 5, a link loss severity of 2, a maximum tolerable differential delay of 5, and 2 redundant links
flyers01.1.17.AUSM.a > cnfimagrp 1 -rwdiff 5 -severity 2 -maxdiff 3 -red 2flyers01.1.17.AUSM.a >cnfln
Use the optional cnfln command to configure line characteristics after the line becomes active (see addln). Applicable cards are the core cards and service modules. For the PXM1 and optional SRM, a syntax switch or command delineator is necessary to identify the interface type as well as the parameters. (See syntax descriptions that follow.)
Note
Full Name
Configure Line
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Note
On all PXM interfaces, a loopback is available. The local loopback exists between the daughter card and the back card. The remote loopback exists between the CPE or switch and the PXM daughter card.With a remote loopback, the data originates on the CPE or external switch, arrives at the PXM daughter card, then returns to the remote equipment. (See .)
Figure 1-4 Local and Remote Loopbacks on the PXM
Syntax: PXM (SONET)
cnfln -sonet <LineNum> -slt <LineType> -lpb <LoopCmd> -smask <HCSmasking>
-sps <PayloadScramble> -sfs <FrameScramble>Syntax Description
Syntax: PXM (T3)
cnfln -ds3 <LineNum> -lc <LineCoding> -len <LineLength> -oof <LineOOFCriteria>
-cb <LineAIScBitsCheck> -lpb <LoopCmd> -rfeac <LineRcvFEACValidation>Syntax Description
Syntax: PXM E3
cnfln -e3 <LineNum> -lc <LineCoding> -len <LineLength> -lpb <LoopCmd>
-topt <TrailTraceOption> -txtt <txTrailTrace> -txma <txTimingMarker>
-rxma <rxTimingMarker> -txpt <txPayloadType>Syntax Description
Syntax: FRSM 8T1, 8E1, 2CT3
cnfln <line_num> <line_type> <clk_src>
Syntax Description
Syntax: FRSM 2T3, 2E3, 2CT3, HS2
cnfds3ln <line_num> <line_type> <line_len> <clk_src>
Syntax Description
Syntax: FRSM HS1/B
cnfln <line_num> <line_type> <line_rate>
Syntax Description
AUSM, CESM, VISM (for T1 or E1)
cnfln <line_num> <line_code> <line_len> <clk_src> [E1-signaling]
Syntax Description
Related Commands
addln, delln, dsplns, dspln
Attributes
Log: Yes State: Active Privilege: 1Example 1-104 Configure line 4 on the current card (an AUSM in slot 4) to be T1 with B8ZS line coding, have a length of 10, and use the loop clock as a clock source
wilco.1.4.AUSM.a > cnfln 4 2 10 1wilco.1.4.AUSM.a >cnflnsubrate
Use cnflnsubrate to configure the T/E3 line subrate mode. This command provides T3/E3 line sub-rates for Digital Link and ADC Kentrox DSUs.
Possible errors associated with this command are
•
•
•
Software Version
Command available with 1.1.20 and higher.
Full Name
Configure Line Subrate
Card(s) on Which This Command Executes
FRSM-2T3/2E3
Syntax
cnflnsubrate <line_num> <dsu_subrate_ena> <dsu_select> <dsu_scramble_ena> <dsu_line_rate >
Syntax Description
.
Related Commands
dspds3ln
Attributes
Log: Yes State: Active Privilege: 1-2cnfname
Use the cnfname PAR command to set the switch name. The name can consist of letters, special characters "_" and "-" and numbers. It must begin with a letter and cannot contain spaces. The name is case sensitive.
Full Name
Configure Name
Card(s) on Which This Command Executes
PXM
Syntax
cnfname <node name>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1Example 1-105 The prompt returns with the new name. However, on the command line, the name is truncated to eight characters because of the information displayed in the prompt
NODENAME.1.7.PXM.a > cnfname kanchendzongakanchend.1.3.PXM.a >cnfoamlpbk
Use the cnfoamlpbk command to configure the OAM loopback test. This nonintrusive test sends OAM cells to an idle PVC, one not receiving data for a whole minute, to verify connection continuity. No remote end loopback is necessary for this test to run. OAM cells are automatically recognized and returned without the need for the remote end to be looping back all data. If the end points reside in Fast Packet cards, then "test delay" cells are transmitted instead of OAM loopback cells.
The OAM cell is initiated at an end point and sent into the network, where it will be returned by the card at the remote end of the connection. (Note that the cells do not go through NNI trunks.) When ten consecutive cells are not received, the PVC is declared failed. The test logs alarms when significant continuous cell loss is encountered.
Once a failed PVC is detected, the local end from which the test started sends a network message to the end point node indicating a failure. This provides consistent network views for both ends of the connection.
Full Name
Configure OAM Loopback
Card(s) on Which This Command Executes
FRSM 2T3/E3, FRSM HS2
Syntax
cnfoamlpbk <action> <frequency>
Syntax Description
action
One of the following actions:
•
•
frequency
Frequency at which the loopback cells should be sent, in the range 1 to 10 minutes.
Related Commands
dspoamlpbk
Attributes
Log: Yes State: Any Privilege: AnyExample 1-106 Send OAM cells every 10 minutes on an FRSM-2CT3 card
NODENAME.1.19.VHS2CT3.a > cnfoamlpbk 1 10NODENAME.1.19.VHS2CT3.a >cnfpasswd
Use the cnfpasswd command to set the password for the specified User ID. Enter the command without arguments to change your own password. Prompts are presented to let you enter the new password and to confirm it.
Full Name
Configure Password
Card(s) on Which This Command Executes
PXM
Syntax
cnfpasswd [<user_id>]
Syntax Description
Related Commands
cnfpwd
Attributes
Log: Yes State: Active Privilege: AnyExample 1-107 Change your own password. Prompts appear for you to enter the new password and confirm it.
spirit4.1.8.PXM.a > cnfpasswdEnter password:Re-enter password:spirit4.1.8.PXM.a >cnfplpp
Use the cnfplpp command to set PLPP parameters on the current AUSM card.
Full Name
Configure PLPP
Card(s) on Which This Command Executes
AUSM
Syntax
cnfplpp <phy_port_num> <loopback> <scramble> <singlebit_errcorr_ena>
Syntax Description
Related Commands
dspplpp
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-108 Configure the PLPP parameters on port 1 on the current AUSM card in slot 22 to disable cell scramble, to disable PLPP loopback, and to disable single-bit error correction.
spirit3.1.22.AUSM8.a > cnfplpp 1 1 1 1spirit3.1.22.AUSM8.a >A system response does not occur unless an error is detected. To confirm your configurations for PLPP parameters, use the dspplpp command.
Example 1-109 Confirm PLPP configuration
spirit3.1.22.AUSM8.a > dspplpp 1PhysicalPortNumber: 1CellFraming: ATMCellScramble: No ScramblePlpp Loopback: No LoopbackSingle-bit error correction: Disabledspirit3.1.22.AUSM8.a >cnfport
Use the cnfport command to configure service port on an FRSM or a PXM. The configuration can be verified using the dspport command.
Full Name
Configure Port
Card(s) on Which This Command Executes
PXM, FRSM
Syntax: PXM
cnfport <port_number> <percent_bandwidth> <min_VPI> <max_VPI>
Syntax Description
Syntax: FRSM
cnfport <port_num> <lmi_sig> <asyn> <ELMI> <T391> <T392> <N391> <N392> <N393>
Syntax Description
Related Commands
addport, delport, dspport, dspports
Attributes
Log: Yes State: Active Privilege: AnyExample 1-110 Configure the port parameters on PXM port 1, in slot 8, to allocate all the bandwidth and to set the VPI range for 0-4095
spirit3.1.8.PXM.a > cnfport 1 100 0 4095spirit3.1.8.PXM.a >cnfportcllm
Use the cnfportcllm command to set Consolidated Link Layer Management (CLLM) parameters for a specified port on the current card. Use CLLM to pass ForeSight to another Cisco WAN switching network using NNI.
Full Name
Configure Port CLLM
Card(s) on Which This Command Executes
FRSM
Syntax
cnfportcllm <port_num> <CLLMEN> <CLLMTM>
Syntax Description
Related Commands
dspportcllm
Attributes
Log: Yes State: Active Privilege: 1-2cnfportq
Use the cnfportq command to configure queue parameters for a specified port on the current AUSM. A system response does not occur unless an error is detected.
Full Name
Configure Port Queue
Card(s) on Which This Command Executes
AUSM
Syntax
cnfportq <port_num> <q_num> <q_algo> <q_depth> <clp_high> <clp_low> <efci_thres>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1cnfportrscprtn
Use the cnfportrscprtn command to configure the resources each controller application receives at a port.
You need to configure partitions at the port level if:
•
•
Full Name
Configure Port Resource Partition
Card(s) on Which This Command Executes
PXM, AUSM, FRSM, CESM, VISM
Syntax: PXM
cnfportrscprtn <if_num> <ctrlr_num> <ingr_pct_bw> <egr_pct_bw> <min_vpi> <max_vpi> <min_vci> <max_vci> <max_chans>
Syntax Description
Syntax: AUSM, FRSM, CESM, VISM
cnfportrscprtn <portnum> <controller> <conn ID range> <percent bandwidth> [number of conns]
Syntax Description
Related Commands
addcdrscprtn, cnfcdrscprtn
Attributes
Log: Yes State: Active Privilege: 1 (Service for PXM)cnfprfparam
Use the cnfprfparam command to configure the bucket interval.
Full Name
Configure Preference Parameters
Card(s) on Which This Command Executes
PXM
Syntax
cnfprfparam <bucket interval>
Syntax Description
Related Commands
dspprf, dspprfhist
Attributes
Log: No State: Active Privilege: AnyExample
popeye3.1.8.PXM.a > cnfprfparam 2The bucket interval will be effective after the current bucket interval is over.popeye3.1.8.PXM.a >cnfrscprtn
Use the cnfrscprtn command to modify an existing resource partition. Refer to the description of addrscprtn for information on resource partitions.
A resource partition on a PXM consists of a percent of bandwidth, a VPI/VCI range, and the number of global logical connection numbers (GLCNs) available to a network control application. The current network control applications are Portable AutoRoute (PAR) and Tag Switching.
Full Name
Configure Resource Partition
Card(s) on Which This Command Executes
PXM
Syntax
cnfrscprtn <if_num> <ctrlr_num> <ingr_pct_bw> <egr_pct_bw> <min_vpi> <max_vpi> <min_vci> <max_vci> <max_chans>
Syntax Description
Related Commands
addrscprtn, delrscprtn, dspifrsc, dspifs, dsprscprtns, dsprscprtn, dsplnrsc
Attributes
Log: Yes State: Any Privilege: Service_GPExample 1-111
MGX-01.1.2.PXM.a > cnfrscprtn 1 1 100 100 0 4095 0 65535 32767MGX-01.1.2.PXM.a >cnfserialif
Use the cnfserialif command to configure the speed of a serial port.
Full Name
Configure Serial Interface
Card(s) on Which This Command Executes
PXM
Syntax
cnfserialif -if <serial_port_num> -sp <serial_port_speed>
Syntax Description
Related Commands
dspserialif
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-112 Configure the speed on slip for 19200bps
NODENAME.1.7.PXM.a > cnfserialif -if 2 -sp 3NODENAME.1.7.PXM.a > dspserialif -if 2SerialPortNum : 2SerialPortType : mainSerialPortEnable : EnableSerialPortBps : 19200bpscnfslftst
Use the cnfslftst command configure the self-test routine on the current card.
Full Name
Configure Self-Test
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
cnfslftst -en <SelftestEnable> -tm <SelftestPeriod>
Syntax Description
-SelftestEnable
Enable or disable self-test.
•
•
SelftestPeriod
Period, in minutes, between self tests in the range 1-60.
Related Commands
clrslftst, dspslftst, runslftstno
Attributes
Log: No State: Any Privilege: AnyExample 1-113 Enable the self-test for the AUSM in slot 22, with a self-test period of five minutes
spirit3.1.22.AUSM8.a > cnfslftst -en 2 -tm 5spirit3.1.22.AUSM8.a >cnfsnmp
Use the cnfsnmp command to view the community strings configured on a service module. The default SNMP community string is set to POPEYE.
Full Name
Configure SNMP
Card(s) on Which This Command Executes
PXM
Syntax
cnfsnmp <community string>
Syntax Description
Related Commands
cnfsnmp
Attributes
Log: No State: Active Privilege: SuperuserExample 1-114 Configure the SNMP community string
popeye.1.7.PXM.a > cnfsnmp POPEYE2STpopeye.1.7.PXM.a > dspsnmpCommunity String :POPEYE2STcnfsrmclksrc
Use the cnfsrmclksrc command to configure the SRM clock source to be acquired from either the PXM or from an SRM-3T3 T3 line.
Full Name
Configure SRM Clock Source
Card(s) on Which This Command Executes
PXM
Syntax
cnfsrmclksrc -ds3 <T3 line number> -srmclk <source number>
Syntax Description
Related Commands
dspsrmclksrc
Attributes
Log: No State: Active Privilege: Anycnfstatsmgr
Use the cnfstatsmgr command to specify the IP address of the workstation with the statistics manager to the MGX 8800 series switch node. If the node on an MGX 8800 series switch does not have this IP address, it refuses requests for statistical information from the workstation that is running Cisco WAN Manager.
Full Name
Configure Statistics Manager
Card(s) on Which This Command Executes
PXM
Syntax
cnfstatsmgr <IP_Addr>
Syntax Description
Related Commands
dsptrapmgr
Attributes
Log: Yes State: Active Privilege: SuperUsercnfswfunc
Use the cnfswfunc PAR command to set certain node-level, paid features on an MGX 8800 series switch. The features are the feeder implementation of the switch and virtual source/virtual destination (VSVD) control for ABR traffic. The defaults are disabled for VSVD and the routing implementation of the MGX 8800 series switch.
Full Name
Configure Software Function
Card(s) on Which This Command Executes
PXM
Syntax
cnfswfunc -vsvd <enable(yes) | disable(no)> -ndtype <fdr | routing>
Syntax Description
Note
Related Commands
dspswfunc
Attributes
Log: No State: Active Privilege: ServiceExample 1-115
wilco.1.7.PXM.a > cnfswfunc -vsvd yes -ndtype routingwilco.1.7.PXM.a >cnftime
Use the cnftime command to set the time on the PXM. The node uses a 24-hour clock.
Full Name
Configure Time
Card(s) on Which This Command Executes
PXM
Syntax
cnftime <hh:mm:ss>
Syntax Description
hh:mm:ss
Hour, minutes, seconds
•
•
•
Related Commands
cnftmzn, cnfdate
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-116 Set time for 2 p.m. plus 11minutes and 22 seconds
excel.1.3.PXM.a > cnftime 14:11:2211/14/98-14:11:22 3 tDbgCmdTask 1220 informational : TIME/DATE updated11/14/98-14:11:22 3 StrataCom 0 cnftime 14:11:22excel.1.3.PXM.a >cnftmzn
Use the cnftmzn command to configure the time zone for the switch.
Full Name
Configure Timezone
Card(s) on Which This Command Executes
PXM
Syntax
cnftmzn <timezone>
Syntax Description
Related Commands
cnftime, cnfdate
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-117 Configure the time zone in the node to U.S. Central Standard Time
excel.1.3.PXM.a > cnftmzn 3excel.1.3.PXM.a >cnftmzngmt
Use the cnftmzngmt command to configure the time zone for the shelf relative to GMT.
Full Name
Configure Timezone Relative to GMT
Card(s) on Which This Command Executes
PXM
Syntax
cnftmzngmt <timeoffsetGMT>
Syntax Description
Related Commands
cnftmzn, cnftime, cnfdate
Attributes
Log: Yes State: Active Privilege: SuperuserExample 1-118 Set time zone in the shelf to GMT plus 4 hours
excel.1.3.PXM.a > cnftmzngmt 4excel.1.3.PXM.a >cnftrafficgen
Use the cnftrafficgen command to configure a traffic generation test. This test is used for troubleshooting cell loss and is intended for use with defective PVCs. This test is enabled or disabled at a connection level, not at a card level.
Software Version
Command available with 1.1.20 and higher.
Full Name
Configure Traffic Generation Test
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
cnftrafficgen <pvc_num> <action> <num_frames> <pattern_type >
Syntax Description
Related Commands
dsptrafficgen
Attributes
Log: No State: Active Privilege: AnyExample 1-119 Start traffic generation test on connection 16 for 100 frames with a pattern type of 1
spirit.1.1.VHS2CT3.a > cnftrafficgen 16 1 100 1Wait......Starting TestExample 1-120 Stop traffic generation test on connection 16
spirit.1.1.VHS2CT3.a > cnftrafficgen 16 2Wait....Stopping Testcnftrapip
Use the cnftrapip command to configure the IP address to be used in all out-going traps from the shelf. This should be configured to one of the interface addresses. The system displays errors if they occur.
Full Name
Configure Trap IP Address
Card(s) on Which This Command Executes
PXM
Syntax
cnftrapip <ip_addr>
Syntax Description
Related Commands
None
Attributes
Log: No State: Active Privilege: AnyExample 1-121
spirit4.1.8.PXM.a > cnftrapip 192.169.3.102spirit4.1.8.PXM.a >cnftrk
Use the cnftrk command to configure various trunk parameters. Execute this command after you have configured the interface as a routing trunk using the cnfifastrk command and activated the trunk on a node through the addtrk command.
Full Name
Configure Trunk
Card(s) on Which This Command Executes
PXM
Syntax
Note
cnftrk -slot.port slot.port [-stres <Stats Reserve> | -ccRstr <CC Restrict> | -lnTyp <Line Type> | -passSync <yes/no> | -drtdly <Deroute Delay(ms)> | -fst <yes/no> |
-fr <yes/no> | -nts <yes/no> | -ts <yes/no> | -voice <yes/no> | -cbr <yes/no> | -vbr <yes/no> |
-abr <yes/no> | -rtcost <Routing Cost> | -vpcconid <Max VPC Con IDs>Syntax Description
Related Commands
addtrk, dsptrks, dsptrkcnf, dsptrkload
Attributes
Log: No State: Active Privilege: 2Example 1-122
tango1.1.8.PXM.a > cnftrk 7.1-stres 1000 -ccrstr no -lntyp s -passsync yes -drtdly 0 -fst yes -fr yes -nts yes -ts yes -voice yes -cbr yes -vbr yes -abr yes -rtcost 10 -vpcconid 255tango1.1.8.PXM.a >cnfupcabr
Use the cnfupcabr command to configure bandwidth control parameters for ABR connections on the current AUSM. No messages appear on-screen unless an error occurs.
Full Name
Configure Parameter Control for ABR
Card(s) on Which This Command Executes
PXM, AUSM-8T1/E1
Syntax for PXM
cnfupcabr <chan_num> <enable> <pcr[0+1]> <cdvt[0+1]> <scr> <scr_police> <mbs> <clp_tag>
Syntax Description
Syntax for AUSM-8T1E1
cnfupcabr <port.VPI.VCI | chan_num> <enable> <pcr[0+1]> <cdvt[0+1]> <scr> <scr_police> <mbs> <clp_tag>
Syntax Description
Related Commands
dspcon, dspcons, cnfupccbr, cnfupcvbr
Attributes
Log: Yes State: Active Privilege: 1-2 (Any for PXM)Example 1-123 Configuring bandwidth control parameters for ABR connections on the current AUSM (using the port.VPI.VCI argument)
s1.1.12.AUSMB8.a > cnfupcabr 2.1.5 2 3000 250000 2000 1 1000 50 4000 50 2Example 1-124 Configuring bandwidth control parameters for ABR connections on the current AUSM (using the channel number argument)
s1.1.12.AUSMB8.a > cnfupcabr 31 2 3000 250000 2000 1 1000 50 4000 50 2cnfupccbr
Use the cnfupccbr command to set connection bandwidth control parameters for the constant bit rate (CBR) connection type on the current AUSM.
No messages appear on-screen unless an error occurs.
Full Name
Configure User Parameter Control Constant Bit Rate
Card(s) on Which This Command Executes
PXM, AUSM
Syntax for PXM
cnfupccbr <chan_num> <enable|disable> <pcr[0+1]> <cdvt[0+1]> <pcr[0]> <cdvt[0]> <clp_tag>
Syntax Description
Syntax for AUSM-8T1E1
cnfupccbr <port.VPI.VCI | ChanNum> <enable|disable> <pcr[0+1]> <cdvt[0+1]> <IngPcUtil> <EgSrvRate> <EgPcUtil>
Syntax Description
Related Commands
dspcon, dspcons, cnfupcabr, cnfupcvbr
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-125 Set connection bandwidth control parameters for the constant bit rate (CBR) connection type on the current AUSM (using port.VPI.CVI argument)
s1.1.12.AUSMB8.a > cnfupccbr 2.1.1 2 4528 250000 50 4528 50Example 1-126 Set connection bandwidth control parameters for the constant bit rate (CBR) connection type on the current AUSM (using channel number argument)
s1.1.12.AUSMB8.a > cnfupccbr 21 2 4528 250000 50 4528 50cnfupcubr
Use the cnfupcubr command to configure the usage parameter control (UPC) parameters for unspecified bit rate (UBR) on the current AUSM8 card. No messages appear on-screen unless an error occurs.
Full Name
Configure User Parameter Control Unspecified Bit Rate
Card(s) on Which This Command Executes
PXM, AUSM-8T1E1
Syntax for PXM
cnfupcubr <chan_num> <enable> <pcr[0-1]> <cvdt[0-1]> <IngPcUtil> <clp_tag>
Syntax Description
Syntax for AUSM-8T1E1
cnfupcubr <port.VPI.VCI | chan_num> <enable> <pcr[0-1]> <cvdt[0-1]> <IngPcUtil> <clp_tag>
Syntax Description
Related Commands
dspcon, dspcons, cnfupcabr, cnfupcvbr
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-127 Configuring the usage parameter control (upc) parameters for unspecified bit rate (ubr) on the current AUSM8 card (using the port.VPI.VCI argument)
s1.1.12.AUSMB8.a > cnfupcubr 2.1.7 2 4528 250000 50 2Example 1-128 Configuring the usage parameter control (upc) parameters for unspecified bit rate (ubr) on the current AUSM8 card (using the channel number argument)
s1.1.12.AUSMB8.a > cnfupcubr 37 2 4528 250000 50 2cnfupcvbr
Use the cnfupcvbr command to configure channel bandwidth control parameters for a variable bit rate (VBR) connection type on the current AUSM. No messages appear on-screen unless an error occurs.
Full Name
Configure User Parameter Control Variable Bit Rate
Card(s) on Which This Command Executes
PXM, AUSM-8T1E1
Syntax for PXM
cnfupcvbr <chan_num> <enable> <pcr[0+1]> <cdvt[0+1]> <scr> <scr_police> <mbs> <clp_tag>
Syntax Description
Syntax for AUSM-8T1E1
cnfupcvbr <port.VPI.VCI | chan_num> <enable> <pcr[0+1]> <cdvt[0+1]> <scr> <scr_police> <mbs> <IngPcUtil> <EgSrvRate> <EgPcUtil> <clp_tag>
Syntax Description
Related Commands
dspcon, dspcons, cnfupcabr, cnfupccbr
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-129 Configuring channel bandwidth control parameters for a variable bit rate (VBR) connection type on the current AUSM (using the port.VPI.VCI argument)
s1.1.12.AUSMB8.a > cnfupcvbr 2.1.3 2 3000 250000 2000 1 1000 50 4000 50 2Example 1-130 Configuring channel bandwidth control parameters for a variable bit rate (VBR) connection type on the current AUSM (using the channel number argument)
s1.1.12.AUSMB8.a > cnfupcvbr 26 2 2 3000 250000 2000 1 1000 50 4000 50 2cnfvismip
Use the cnfvismip command to configure the VISM IP address and the signaling unit (SU) IP address on the VISM card. An IP address for each VISM is necessary for it to communicate with the SU and serves as the identifier for VoIP endpoints. Together, the VISM IP address and the local RTP port identify the bearer channel of each VoIP connection.
Any of the above three parameters can be configured with the cnfvismip command. It is possible to configure all of them in a single command invocation or separate invocations. Once configured, these IP addresses will be stored on the hard disk on the PXM and will be retrieved from there for subsequent reboots of the card.
Note
Full Name
Configure VISM IP Address
Card(s) on Which This Command Executes
VISM
Syntax
cnfvismip -cuip <VISM IP address> | -mask <net mask> | -suip <SU IP address>
Syntax Description
commit
Use the commit command to confirm copying the selected firmware file into the PXM.
Full Name
Confirm Copying the Firmware Load
Card(s) on Which This Command Executes
PXM
Syntax
commit <version>
Syntax Description
Related Commands
dspupgrade, rstupgrade, newrev, dspfwrevs, printrev, copy, install, abort
Attributes
Log: Yes State: Active Privilege: AnyExample 1-131 Loading firmware 1.1.10
NODENAME.1.8.PXM.a > commit 1.1.10this may take a while ...commit command completed okExample 1-132 Commit command errors (multiple cases)
NODENAME.1.8.PXM.a > commit 1.1.11in 'upgrade idle', must be in 'upgrade newrev'ERR: command "commit" failedNODENAME.1.7.PXM.a > commit 1.1.111.1.11 is not the currently running version 1.1.10HuERR: command "commit" failedExample 1-133 Loading firmware on a Service Module
golden1.1.7.PXM.a > commit sm 11 10.0.05Do you want to proceed (Yes/No)? yesExample 1-134 Errors loading firmware on a Service Module
golden1.1.7.PXM.a > commit sm 11 10.0.04Incorrect version : 10.0.04usage: commit [sm <slot>] <version>ERR: command "commit" failedcopy
Use the copy command to replicate the selected firmware file into the PXM.
Full Name
Copy the Firmware Load
Card(s) on Which This Command Executes
PXM
Syntax
copy <fw_load>
Syntax Description
Related Commands
abort, commit, cp
Attributes
Log: No State: Any Privilege: AnyExample 1-135 Copy loading firmware file named pxm_1.0.00Ef.fw
spirit4.1.8.PXM.a > copy pxm_1.0.00Ef.fwspirit4.1.8.PXM.a >cp
Use the cp command to replicate the selected firmware file into the PXM.
Full Name
Copy the firmware load
Card(s) on Which This Command Executes
PXM
Syntax
copy <fw_load>
Syntax Description
Related Commands
abort, commit, copy
Attributes
Log: No State: Any Privilege: AnyExample 1-136 Copy loading firmware file named pxm_1.0.00Ef.fw
spirit4.1.8.PXM.a > copy pxm_1.0.00Ef.fwspirit4.1.8.PXM.a >cth
Use the cth command to clear the transaction handler trace buffer.
Full Name
Clear Transaction Handler
Card(s) on Which This Command Executes
PXM
Syntax
cth
Related Commands
thtrace, dth
Attributes
Log: No State: Any Privilege: Service GroupExample 1-137
spirit4.1.8.PXM.a > cthspirit4.1.8.PXM.a >copychans
Use the copychans command copy a channel configuration onto one or more channels. This command enables you to create and configure multiple channels from a specified "template" channel.
Full Name
Copy Channels
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
copychans <template chan #> <start chan #> <start dlci> <# of chans> <start remote VPI> <start remote VCI>
Syntax Description
Related Commands
delchan, delchans
Attributes
Log: No State: Active Privilege: 1copyports
Use the copyports command to copy a port configuration to one or more ports. The purpose of this command is to create and configure multiple ports from a single port that serves as a template.
Full Name
Copy Ports
Card(s) on Which This Command Executes
FRSM (not on the HS1/B)
Syntax
copyports <template port #> <start port #> <start time slot> <# of ports>
Syntax Description
Related Commands
delport, delports
Attributes
Log: No State: Active Privilege: 1
cvsi
Use the cvsi command to clear the VSI trace buffer.
Full Name
Clear VSI
Card(s) on Which This Command Executes
PXM
Syntax
cvsi
Related Commands
vsitrace, dvsi
Attributes
Log: No State: Any Privilege: Cisco GroupExample 1-138 Clear VSI on the current PXM
spirit4.1.8.PXM.a > cvsispirit4.1.8.PXM.a >dcct
Use the dcct command to display connection information.
Full Name
Display Connection
Card(s) on Which This Command Executes
PXM
Syntax
dcct <slot.port.vpi.vci>
Syntax Description
Related Commands
None
Attributes
Log: No State: Active Privilege: Service GroupExample 1-139 Example: Show connection information for the card in slot 2
porky.1.7.PXM.a > dcct 6.2.100.100Connection does not existporky.1.7.PXM.a >dcondb
Use the dcondb command to view a connection database.
Full Name
Display Connection Database
Card(s) on Which This Command Executes
PXM
Syntax
dcondb <dbtype> <index>
Syntax Description
dbtype
Value to set the
•
•
•
•
index
Set index for either index or dbtype.
Related Commands
None
Attributes
Log: No State: Any Privilege: Service Groupdel
Use the del command to remove a file or directory from the PXM hard drive.
Full Name
Delete
Card(s) on Which This Command Executes
PXM
Syntax
del <path_name>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Any Privilege: Service Groupdelaimgrp
Use the delaimgrp command to delete an AIMUX group.
Full Name
Delete AIMUX Group
Card(s) on Which This Command Executes
AUSM
Syntax
delaimgrp <group_num>
Syntax Description
Related Commands
addaimgrp, cnfaimgrps, dspaimgrp, dspaimgrps
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-140 Delete AIMUX group 2 on the current AUSM card
spirit3.1.22.AUSM8.a > delaimpgrp 2spirit3.1.22.AUSM8.a >delapsln
Use the delapsln command to delete an APS line configuration.
Full Name
Delete APS Line
Card(s) on Which This Command Executes
PXM
Syntax
delapsln <workingline>
Syntax Description
Related Commands
addapsln, cnfapsln, dspapsln, switchapsln
Attributes
Log: Yes State: Active Privilege: SUPER_GPdelbert
Use the delbert command to conclude a BERT testing session in a specified location on the shelf.
Full Name
Delete BERT
Card(s) on Which This Command Executes
PXM
Syntax
delbert <slot>
Syntax Description
Related Commands
cnfbert, dspbert, modbert, xcnfbert
Attributes
Log: Yes State: Active Privilege: GROUP_1delcdrscprtn
Use the delcdrscprtn command to delete GLCNs allocated to a controller. This command applies if the card partition type is controllerBased.
Full Name
Delete Card Resource Partition
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
delcdrscprtn <controller-name>
Syntax Description
Related Commands
addcdrscprtn, cnfcdrscprtn, dspcdrscprtn
Attributes
Log: Yes State: Any Privilege: SERVICE_GPExample 1-141 Delete the allotment of connections on the current card for the Tag controller
spirit4.1.8.PXM.a > delcdrscprtn 3spirit4.1.8.PXM.a >delchan
Use the delchan command to delete a channel. After you finish this command, no messages appear on-screen unless the command cannot execute as entered.
Full Name
Delete Channel
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
delchan <channel number>
Syntax Description
channel number
Channel number, as appropriate for the card.
•
•
•
–
–
Related Commands
dspchan, addchan, cnfchan
Attributes
Log: Yes State: Any Privilege: Anydelchanloop
Use the delchanloop command to delete a channel loopback from the current FRSM or AUSM.
No messages appear on-screen after command entry unless the command cannot execute as entered.
Full Name
Delete a Channel Loopback
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax: FRSM
delchanloop <chan_num>
Syntax Description
chan_num
Channel number, in the range appropriate for the card.
•
–
–
–
–
Related Commands
addchanloop, tstcon, tstdelay
Attributes
Log: Yes State: Active Privilege: 1-4Syntax for AUSM-8T1E1
delchanloop <port.VPI.VCI | ChanNum>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
ChanNum
Channel number, in the range 16-1015.
Related Commands
addchanloop, tstcon, tstdelay
Attributes
Log: Yes State: Active Privilege: 1-4Example 1-142 Delete channel loopback on a channel number for the current AUSM
s1.1.12.AUSMB8.a > delchanloop 26Example 1-143 Delete channel loopback on port 2, VPI 1, VCI 3 on the current AUSM
s1.1.12.AUSMB8.a > delchanloop 2.1.3delchans
Use the delchans command to delete a range of Frame Relay or ATM channels.
Full Name
Delete Channels
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
delchans <start chan #> <# of chans>
Syntax Description
Related Commands
None
Attributes
Log: No State: Active Privilege: 1delcon
Use the delcon command to remove a connection from the AUSM or VISM card.
Full Name
Delete Connection
Card(s) on Which This Command Executes
PXM, FRSM, CESM, AUSM
Syntax: PXM, CESM
delcon <conn_ID>
Syntax Description
conn_ID
Connection number, as appropriate for the card.
•
•
–
–
Syntax: FRSM,
delcon <port.DLCI>
Syntax Description
Syntax: AUSM
delcon <port.VPI.VCI>
Syntax Description
Related Commands
addcon, dspcons, dspcon
Attributes
Log: Yes State: Active Privilege: 1-2deldsx3bert
Use the deldsx3bert command to end the current test. Value in the BERT counters will remain until you use the clrbertcntrs command.
Full Name
Delete DSX3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax: PXM, CESM, AUSM
deldsx3bert
Related Commands
acqdsx3bert, clrbertcntrs, cnfdsx3bert, dspdsx3bert, moddsx3bert, startdsx3bert
Attributes
Log: No State: Active Privilege: AnyExample 1-144 Stop the current BERT session
popeye1.1.21.CESMT3.a > deldsx3bertpopeye1.1.21.CESMT3.a >Example 1-145 Display results
popeye1.1.21.CESMT3.a > dspdsx3bertBert Control: Default stateBert Resource Status State: FreeBert Owner: CLIBert Status: InactiveBert Test Medium: LineBert Port: 1Line Number : 1Bert Mode : bertPatternTestBert Pattern : allOnesLoopback type: No loopbackStart time (secs.) Not Configured YetStart Date Not Configured YetBit countupper: 80Bit countlower: 1054968191Bit Error Countupper 0Bit Error Countlower 1655197832Error Insertion Rate: Error injection disabledError Insertion count: 0DSX3 BERT in Syncpopeye1.1.21.CESMT3.a >delifip
Use the delifip command to delete a management interface, clearing the database information.
Full Name
Delete a Management Interface
Card(s) on Which This Command Executes
PXM
Syntax
delifip <Interface>
Syntax Description
Related Commands
cnfifip, dspifip
Attributes
Log: Yes State: Any Privilege: SuperUserExample 1-146 Delete the ATM interface (indicated by the number 37)
spirit1.1.8.PXM.a > delifip 37spirit1.1.8.PXM.a >dellink
Use the dellink command to remove a link between a T1 line within a T3 line on an SRM-3T3 card and a slot and line number on a service module.
Full Name
Delete Link
Card(s) on Which This Command Executes
PXM
Syntax
dellink <T3 line number> <T1 line number>
Syntax Description
T3 line number
SRM-3T3 T3 line number in the format slot.port.
•
•
T1 line number
Starting T1 line number, in the range 1-28.
Related Commands
dsplink, addlink
Attributes
Log: No State: Active Privilege: AnyExample 1-147 Delete the link between the first T3 line on the SRM-T3 in slot 15 and T1 line 1
spirit1.1.8.PXM.a > dellink 15.1 1spirit1.1.8.PXM.a >dellmiloop
Use the dellmiloop command to delete a current local management interface (LMI) configuration and resume sending LMI connection status messages to the BPX feeder trunk. This command should be used in conjunction with the delfdrlp command on the BPX module. You first should use dellmiloop on the MGX 8800 series switch, then use delfdrlp on the BPX module. Be aware that there is no display command for the feeder loop on the BPX.
Use the dsplmistats command after you have executed the dellmiloop command on the MGX 8800 switch and the delfdrlp command on the BPX module to verify the delete commands. The LMI statistics table will show an increase in statistics.
Figure 1-5 Status Messages Halted between a MGX 8800 Series Switch and a
BPX Switch, then Enabled again Using dellmiloop and delfdrlp
Full Name
Delete LMI Loop
Card(s) on Which This Command Executes
PXM
Syntax
dellmiloop <slot.port>
Syntax Description
slot.port
A value, where:
•
•
Related Commands
cnfilmi, dspilmi, dspilmicnt, dspilmis, addlmiloop, delfdrlp
Attributes
Log: No State: Active Privilege: Super Group (0)The examples that follow illustrate:
1
2
3
Example 1-148 Delete feeder loop on the BPX
delfdrlp 5.5Example 1-149 Display LMI loop (LMI loop added)
NODENAME.1.7.PXM.a > dsplmiloopTRK IN LMI LOOP-------------------7.1 YesExample 1-150 Delete LMI loop
NODENAME.1.7.PXM.a > dellmiloop 7.1Example 1-151 Display LMI loop (LMI loop deleted)
NODENAME.1.7.PXM.a > dsplmiloopTRK IN LMI LOOP-------------------7.1 Nodelln
Use the delln command to remove a line from the current card.
Full Name
Delete Line
Card(s) on Which This Command Executes
PXM, FRSM, AUSM (8T1/E1;IMATM-T3T1/E3E1), CESM, VISM
Syntax
delln <LineNum>
or
delln <-ds3 | -e3 | -sonet> <LineNum>
(on the PXM)Syntax Description
Note
Related Commands
dspln, addln, cnfln
Attributes
Log: Yes State: Active Privilege: 1Example 1-152 Delete line 4 from the current card
spirit1.1.8.PXM.a > delln 4spirit1.1.8.PXM.a >dellnloop
Use the dellnloop command to remove a T1 or E1 line loopback state for the current card.
Full Name
Delete Line Loop
Card(s) on Which This Command Executes
PXM, AUSM, FRSM, CESM, VISM
Syntax
dellnloop -ds3 | -e3 | -sonet <line number>
Syntax Description
Related Commands
addlnloop
Attributes
Log: No (Yes PXM) State: Active Privilege: -1 (Service) (Any on PXM)dellnsfmaimgrp
Use the dellnsfmaimfrp command to remove lines from an existing AIMUX group.
Full Name
Delete Lines from an AIM Group
Card(s) on Which This Command Executes
AUSM
Syntax
dellnsfmaimgrp <aimux_grp> <list_of_lines>
Syntax Description
aimux_grp
AIMUX group number, in the range 1-8.
list_of_lines
List of lines to be deleted from the AIMUX group. Type a dot between each group number in your entry string.
Related Commands
addlns2aimgrp
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-153 Delete lines 3 and 5 from AIMUX group 2
spirit1.1.8.PXM.a > dellnsfmaimgrp 2 3.5spirit1.1.8.PXM.a >delport
Use the delport command to remove a port from an FRSM, a PXM, or a CESM.
Full Name
Delete Port
Card(s) on Which This Command Executes
PXM, FRSM, CESM
Syntax: PXM
delport <port-number>
Syntax Description
Syntax: FRSM, CESM
delport <port_num>
Syntax Description
Related Commands
addport, cnfport, dspport, dspports
Attributes
Log: Yes State: Active Privilege: 1delports
Use the delports command remove a specified number of contiguous port configurations.
No messages appear on-screen with successful completion of this command.
Full Name
Delete Ports
Card(s) on Which This Command Executes
FRSM, CESM
Syntax
delports <start port #> <# of ports>
Syntax Description
start port #
Start port number to be deleted.
# of ports
Number of contiguous time slots to be deleted.
Related Commands
copyports
Attributes
Log: No State: Active Privilege: 1delred
Use the delred command to remove a redundancy link for the specified primary card slot.
Full Name
Delete Redundancy
Card(s) on Which This Command Executes
PXM
Syntax
delred <redPrimarySlotNumber>
Syntax Description
redPrimarySlotNumber
Slot number of the primary card of the card pair, in the ranges 1-6, or 9-14, or 17-22, or 25-30.
Related Commands
dspred, addred
Attributes
Log: No State: Active Privilege: Anydelrscprtn
Use the delrscprtn command to remove a resource partition. Refer to the description of addrscprtn for information on resource partitions.
Full Name
Delete Resource Partition
Card(s) on Which This Command Executes
PXM, FRSM (not on HS1/B)
Syntax
delrscprtn <if_num> <ctrlr_num>
Syntax Description
if_num
Interface Number, in the range 1-32.
ctrlr_num
Value to set controller number.
•
•
•
Related Commands
addrscprtn
Attributes
Log: No State: Any Privilege: Anydelslotlink
Use the delslotlink command to remove SRM-3T3 link information for a specified slot.
Full Name
Delete Slot Link
Card(s) on Which This Command Executes
PXM
Syntax
delslotlink <slot number> <line number>
Syntax Description
Related Commands
dspslotlink
Attributes
Log: No State: Active Privilege: Anydeltrapmgr
Use the deltrapmgr to delete the specified trap manager associated with the specified IP address.
Full Name
Delete Trap Manager
Card(s) on Which This Command Executes
PXM
Syntax
deltrapmgr <ipaddr>
Syntax Description
Related Commands
addtrapmgr, dsptrapmgr, dsptrapmgrs
Attributes
Log: Yes State: Active Privilege: SuperUserdeltree
Use the deltree command to remove a directory and all files below.
Full Name
Delete Tree
Card(s) on Which This Command Executes
PXM
Syntax
deltree <path_name>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Any Privilege: SUPER_GPdeluser
Use the deluser command to remove a user from the list of users on the node of an MGX 8800 series switch. The system does not allow you to delete a user with a privilege level higher than the level at which you execute the command. For example, if the current user privilege is 2, you cannot delete a user at level 1. No screen output appears unless an error occurs.
Full Name
Delete User
Card(s) on Which This Command Executes
PXM
Syntax
deluser <user ID>
Syntax Description
Related Commands
dspusers, adduser
Attributes
Log: Yes State: Active Privilege: 1-5dir
Use the dir command to view the firmware files on the PXM.
Full Name
Directory
Card(s) on Which This Command Executes
PXM
Syntax
dir
Related Commands
mkdir, rmdir
Attributes
Log: No State: Any Privilege: AnyExample 1-154 List the firmware on the current PXM
raviraj.1.7.PXM.a > dirsize date time name-------- ------ ------ --------512 JUL-03-1999 19:20:44 . <DIR>512 JUL-03-1999 19:20:44 .. <DIR>2089064 JUL-03-1999 13:54:08 pxm_rmenon.old.fw896020 JUL-18-1999 14:18:50 sm130.fw794280 JUL-03-1999 14:56:42 sm35.fw1136684 JUL-03-1999 16:04:50 sm50.fw2094828 JUL-16-1999 14:29:06 pxm_rmenon.fwIn the file system :total space : 819200 K bytesfree space : 742625 K bytesraviraj.1.7.PXM.a >dlmi
Use the dlmi command to display the data captured as a result of executing the lmitrace command. You first must use the lmitrace command to capture the data, then the dlmi command to display the data.
Full Name
Display LMI trace
Card(s) on Which This Command Executes
PXM
Syntax
dlmi
Related Commands
lmitrace (to capture lmi messages) clmi (to clear lmi buffer)
Attributes
Log: No State: Any_State Privilege: Cisco_GpExample 1-155 Display when the LMI trace buffer is empty
NODENAME.1.8.PXM.a > dlmiLMI Trace Buffer is emptyExample 1-156 Display when the LMI trace buffer contains data (resulting from the lmitrace command)
NODENAME.1.8.PXM.a > dlmiNo. Time(mSecs) AbsTime Ltrk Dir MsgType Length Data0 0 171519360 1 Rx 76 28[ 09 03 ff ff ff 76 80 00 13 66 80 00 01 04 5a 80 00 05 80 00 03 00 1f 64 80 00 01 d3 ]1 0 171519360 1 Tx 7e 32[ 09 03 ff ff ff 7e 80 00 13 66 80 00 01 04 65 80 00 05 00 03 00 1f 82 64 80 00 01 d3 0d 0000 00 ]2 +26 171519880 1 Tx 76 32[ 09 03 ff ff ff 76 80 00 13 66 80 00 01 04 5a 80 00 05 80 00 03 00 1f 64 80 00 01 1b 0d 0000 00 ]dnif
Use the dnif command to deactivate the specified broadband interface.
Note
Full Name
Down Interface
Card(s) on Which This Command Executes
PXM
Syntax
dnif <if_num>
Syntax Description
Related Commands
cnfif, dspif, upif
Attributes
Log: No State: Active Privilege: 1dnilmi
Use the dnilmi command to deactivate the Integrated Local Management Interface (ILMI) on a specified PXM port number.
Full Name
Down ILMI
Card(s) on Which This Command Executes
PXM
Syntax
dnilmi -ifNum <bbIfSigPortNum>
Syntax Description
-ifNum
Command delineator that precedes the bbIfSigPortNum entry.
bbIfSigPortNum
Broadband interface signal port number, in the range 1-32.
Related Commands
cnfilmi, dspilmi, dspilmicnt, dspilmis, upilmi
Attributes
Log: No State: Any Privilege: CISCO_GPdownloadflash
Use the downloadflash command to load the first boot code found by the PXM hard drive into EEPROM (flash memory). A downloadflash session concludes the sequence of tasks for performing a PXM boot code load. Prior to executing the downloadflash command, you must access the boot code, transfer the file (using a "put" command) to the PXM hard drive.
Using various arguments with the "put" command enables boot code load unto both the standby and active PXM, or to the active PXM only, or to the standby PXM only. Details are provided in the example below.
Note
Once firmware is installed in slot 7, the firmware file is mirrored to a PXM subsequently installed in slot 8. For safe measure, however, you should manually download the boot code (using the downloadflash command onto the standby PXM.
Full Name
Download the Flash
Card(s) on Which This Command Executes
PXM
Syntax
downloadflash
Related Commands
Attributes
Log: No State: Any Privilege: SUPER_GPExample 1-157 Example: Do a PXM boot code load, starting with a TFTP to the boot code source, and ending with the download to the standby and the active PXM.
tftp <dest_addr> (of the switch) bin put pxm_bkup_version>.fw POPEYE@PXM.BT quitwilco.1.7.PXM.a > downloadflash
Note
•
put pxm_bkup_version>.fw POPEYE@PXM_ACTIVE.BT•
put pxm_bkup_version>.fw POPEYE@PXM_STANDBY.BTdnport
Use the dnport command to deactivate a port.
Full Name
Down Port
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
dnport <PortNum>
Syntax Description
Related Commands
upport
Attributes
Log: No State: Active Privilege: 1dspaimgrp
Use the dspaimgrp command to view detailed status and configuration information for a specified AIMUX group.
Full Name
Display AIM Group Status and Configuration
Card(s) on Which This Command Executes
AUSM
Syntax
dspaimgrp <imagroup_number>
Syntax Description
Related Commands
addaimgrp, delaimgrp, cnfaimgrps, dspaimgrps
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-158 Display all the detailed status and configuration information for AIMUX group 1 on the current card.
spirit.1.19.AUSM8.a > dspaimgrp 1IMA Group number : 1Port type : NNILines configured : 1.2.3Enable : EnabledIMA Port state : Sig. FailureIMA Group Ne state : StartupPortSpeed (cells/sec) : 13470GroupTxAvailCellRate (cells/sec) : 0ImaGroupTxFrameLength(cells) : 128LcpDelayTolerance (IMA frames) : 1ReadPtrWrPtrDiff (cells) : 4Minimun number of links : 2MaxTolerableDiffDelay (msec) : 200Lines Present :ImaGroupRxImaId : 0x100ImaGroupTxImaId : 0x0Observed Diff delay (msec) : 0Clock Mode : CTCGroupAlpha : 2GroupBeta : 2GroupGamma : 1Type <CR> to continue, Q<CR> to stop:GroupConfiguration : 1IMAGrp Failure status : Ne StartUpTiming reference link : 1Syntax : dspimagrp (or dspaimgrp) "imagroup_number"IMA group number -- value ranging from 1 to 8spirit.1.19.AUSM8.a >dspaimgrpcnt
Use the dspaimgrpcnt command to view all AIMUX related counters for a line in an AIMUX group.
Full Name
Display AIM Group Count
Card(s) on Which This Command Executes
AUSM
Syntax
dspaimgrpcnt <imagroup>
Syntax Description
Related Commands
clraimgrpcnt
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-159 Display all the AIMUX related counters for AIMUX group 1 on the current card
spirit.1.19.AUSM8.a > dspaimgrpcnt 1IMA Group number: 1Ne Number of failures : 0Syntax : dspimagrpcnt (or dspaimgrpcnt) imagroupIMA group number -- value ranging from 1 to 8spirit.1.19.AUSM8.a >dspaimgrps
Use the dspaimgrps command to view the status and configuration information for all current AIMUX groups.
Full Name
Display Status and Configuration of All AIM Groups
Card(s) on Which This Command Executes
AUSM
Syntax
dspaimgrps
Related Commands
addaimgrp, delaimgrp, cnfaimgrps, dspaimgrp
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-160 Display the status and configuration information for all AIMUX groups on the current card
spirit.1.19.AUSM8.a > dspaimgrpsList of IMA groups:===================ImaGrp PortType Speed Lines configured Lines present Tol Diff Port StateDelay(ms)------ -------- ----- ---------------- ------------- --------- ----------19.1 NNI 13470 1.2.3 200 Sig. FailureNextPortNumAvailable: 6Syntax : dspimagrps (or dspaimgrps)spirit.1.19.AUSM8.a >dspaimlncnt
Use the dspaimlncnt command to view all the AIMUX line counters for the specified line in an IMA trunk.
Full Name
Display AIM (or Display IMA) Line Count
Card(s) on Which This Command Executes
AUSM
Syntax
dspaimlncnt <imagroup> <linenum>
Syntax Description
Related Commands
clraimlncnt, clrimalncnt, dspimalncnt
Attributes
Log: No State: Active Privilege: 1Example 1-161 Display the line counters for line 1 of IMA group 1
spirit.1.19.AUSM8.a > dspaimlncnt 1 1IMA group number : 1Line number : 1Acp Cells Received : 0Acp Errored Cells Recvd : 0Port changed from LDS : 0# HEC errored cells : 0# HEC errored seconds : 0# Severely HEC errored seconds : 0Syntax : dspimalncnt (or dspaimlncnt) imagroup linenumIMA group number -- value ranging from 1 to 8line number -- value ranging from 1 to 8spirit.1.19.AUSM8.a >dspalm
Use the dspalm command to view the alarms associated with a specified line.
Full Name
Display Alarms for a Line
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Old Syntax
dspalm -ds1 <LineNum> | -ds3 <LineNum> | -e3 <LineNum> | -plcp <PCLPNum> | -sonet <LineNum>
New Syntax
dspalm -ds1 <LineNum> | -ds3 <LineNum> | -e3 <LineNum> | -plcp <PCLPNum> | -sonet <LineNum> |
-hs1 <LineNum
Syntax Description
Related Commands
clralm, dspalms
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
•
•
Example 1-162 On a PXM, display alarms on the T3 line number 2
spirit.1.7.PXM.a > dspalm -ds3 7.2LineNum: 2LineAlarmState: No AlarmsLineStatisticalAlarmState: No Statistical Alarmsspirit.1.7.PXM.a >Example 1-163 On a PXM, display alarms on OC-3 line 1
spirit.1.7.PXM.a > dspalm -sonet 7.1LineNum: 1SectionCurrentStatus: ClearLineCurrentStatus: ClearPathCurrentStatus: ClearSectionStatAlarmStatus: ClearLineStatAlarmStatus: ClearPathStatAlarmStatus: Clearspirit.1.7.PXM.a >Example 1-164 On a PXM, display alarms on E3 line 1
wilco.1.7.PXM.a > dspalm -e3 7.1LineNum: 1LineAlarmState: XmtRAI,RcvLOSLineStatisticalAlarmState: UAS15minAlarm,UAS24hrAlarmwilco.1.7.PXM.a >Example 1-165 On an AUSM, display alarms on T1 line 1
spirit.1.19.AUSM8.a > dspalm -ds1 1LineNum: 1LineAlarmState: Alarm(s) On --RcvLOSLineStatisticalAlarmState: Alarm(s) On --UAS15minAlarmUAS24hrAlarmspirit.1.19.AUSM8.a >Example 1-166 Display alarms on VISM line 1
spirit.1.5.VISM8.a > dspalm -ds1 1LineNum: 1LineAlarmState: No AlarmsLineStatisticalAlarmState: No Statistical Alarmsspirit.1.5.VISM8.a >Example 1-167 On an FRSM, display alarms on line 3
man.1.4.FRSM.a > dspalm -hs1 3LineNum: 3LineAlarmState: Alarm(s) On --Cabletype mismatch - either (DTE/DCE) or (X.21/V.35)is wrongdspalmcnf
Use the dspalmcnf command to view the threshold information about the alarm statistics being collected.
Full Name
Display Alarm Configuration
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
dspalmcnf -ds1 <LineNum> | -ds3 <LineNum> | -e3 <LineNum> | -plcp <PCLPNum> | -sonet <LineNum>
Syntax Description
Syntax for FRSM-HS1
dspalmcnf -hs1 <LineNum>
Syntax Description
Related Commands
dspalm, dspalms
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
Example 1-168 Display the alarm configuration for FRSM line 4 (slot 17 in this example)
spirit.1.17.FRSM.a > dspalmcnf -ds1 17.4Severity AlarmUpCount AlarmDnCount AlarmThresholdLine Red / RAIS NE / FE NE / FE NE / FE---- ----- ----- ----- ----- ----- ----- ----- -----17.4 Major/Minor 6/1 1500/6 1/1500spirit.1.17.FRSM.a >Example 1-169 Display the alarm configuration for the current PXM
spirit.1.7.PXM.a > dspalmcnf -ds3 7.1LineNum: 1RedSeverity: MajorRAISeverity: MinorNEAlarmUpCount: 6NEAlarmDnCount: 1NEAlarmThreshold: 150FEAlarmUpCount: 6FEAlarmDnCount: 1FEAlarmThreshold: 150StatisticalAlarmSeverity: MinorLCV15minThreshold: 3870LCV24hrThreshold: 38650LES15minThreshold: 86LES24hrThreshold: 864 PSES24hrThreshold: 40LSES15minThreshold: 4 SEFS15minThreshold: 120LSES24hrThreshold: 40 SEFS24hrThreshold: 1200PCV15minThreshold: 382 AISS15minThreshold: 120PCV24hrThreshold: 3820 AISS24hrThreshold: 1200PES15minThreshold: 86 UAS15minThreshold: 120PES24hrThreshold: 864 UAS24hrThreshold: 1200PSES15minThreshold: 4Example 1-170 Display the alarm configuration on the current AUSM for E1 line 1
spirit.1.19.AUSM8.a > dspalmcnf -ds1 1LineNum: 1RedSeverity: MajorRAISeverity: MinorNEAlarmUpCount: 6NEAlarmDnCount: 6NEAlarmThreshold: 1FEAlarmUpCount: 1FEAlarmDnCount: 1500FEAlarmThreshold: 1500StatisticalAlarmSeverity: MinorlCV15minThreshold: 14lCV24hrThreshold: 134lES15minThreshold: 12lES24hrThreshold: 121lSES15minThreshold: 10lSES24hrThreshold: 100cRC15minThreshold: 14cRC24hrThreshold: 134cRCES15minThreshold: 12cRCES24hrThreshold: 121cRCSES15minThreshold: 10cRCSES24hrThreshold: 100SEFS15minThreshold: 2SEFS24hrThreshold: 17AISS15minThreshold: 2AISS24hrThreshold: 17UAS15minThreshold: 10UAS24hrThreshold: 10spirit.1.19.AUSM8.a >Example 1-171 Display the alarm configuration on the current VISM for E1 line 1
spirit.1.5.VISM8.a > dspalmcnf -ds1 1Severity AlarmUpCount AlarmDnCount AlarmThresholdLine Red / RAIS NE / FE NE / FE NE / FE---- ----- ----- ----- ----- ----- ----- ----- -----5.1 Major/Minor 6/6 1/1 1500/1500spirit.1.5.VISM8.a >Example 1-172 Display the alarm configuration on the current FRSM-2T3 for line 1
spirit.1.1.VHS2T3.a > dspalmcnf -ds3 1LineNum: 1RedSeverity: MajorRAISeverity: MinorNEAlarmUpCount: 4NEAlarmDnCount: 3NEAlarmThreshold: 1200FEAlarmUpCount: 4FEAlarmDnCount: 3FEAlarmThreshold: 1200StatisticalAlarmSeverity: MinorLCV15minThreshold: 3870LCV24hrThreshold: 38650LES15minThreshold: 86LES24hrThreshold: 864LSES15minThreshold: 4LSES24hrThreshold: 40PCV15minThreshold: 382PCV24hrThreshold: 3820PES15minThreshold: 86PES24hrThreshold: 864PSES15minThreshold: 4PSES24hrThreshold: 40CCV15minThreshold: 382CCV24hrThreshold: 3820CES15minThreshhold: 86CES24hrThreshold: 864CSES15minThreshold: 4CSES24hrThreshold: 40SEFS15minThreshold: 120SEFS24hrThreshold: 1200AISS15minThreshold: 120AISS24hrThreshold: 1200UAS15minThreshold: 120UAS24hrThreshold: 1200spirit.1.1.VHS2T3.a >dspalmcnt
Use the dspalmcnt command to view the alarm counters and statistics.
Full Name
Display Alarm Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
dspalmcnt -ds1 <LineNum> | -ds3 <LineNum> | -e3 <LineNum> | -plcp <PCLPNum> | -sonet <LineNum>
Syntax Description
Related Commands
clralmcnt, clralmcnts
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
•
•
Example 1-173 Display alarm count for line 1 (T3) of a PXM
wilco.1.7.PXM.a > dspalmcnt -ds3 7.1
LineNum: 1LCVCurrent: 0LCVLast15minBucket: 0LCVLast24hrBucket: 0LESCurrent: 0LESLast15minBucket: 0LESLast24hrBucket: 0LSESCurrent: 0LSESLast15minBucket: 0LSESLast24hrBucket: 0PCVCurrent: 0PCVLast15minBucket: 0PCVLast24hrBucket: 0PESCurrent: 0PESLast15minBucket: 0PESLast24hrBucket: 0PSESCurrent: 0PSESLast15minBucket: 0PSESLast24hrBucket: 0SEFSCurrent: 0SEFSLast15minBucket: 0SEFSLast24hrBucket: 0AISSCurrent: 0AISSLast15minBucket: 0AISSLast24hrBucket: 0UASCurrent: 0UASLast15minBucket: 0UASLast24hrBucket: 0PercentEFS: 0RcvLOSCount: 1RcvOOFCount: 0RcvRAICount: 0RcvCCVCount: 0RcvFECount: 0spirit.1.7.PXM.a >Example 1-174 Display alarms and counters for line 1 on the current FRSM
spirit.1.11.FRSM.a > dspalmcnt -ds1 1Line RcvLOSCount RcvOOFCount RcvRAICount RcvFECount---- ----------- ----------- ----------- ----------11.1 1 2 17 2spirit.1.11.FRSM.a >Example 1-175 Display alarms and counters for line 1 on the PXM with OC-3
spirit11.1.7.PXM.a > dspalmcnt -sonet 7.1SonetLineNum: 1SectionCurrentValidFlag: validSectionCurrent15minTimeElapsed: 429sSectionCurrentESs: 0SectionCurrentSESs: 0SectionCurrentSEFSs: 0SectionCurrentCVs: 0SectionCurrentDayValidFlag: validSectionCurrentDayESs: 100SectionCurrentDaySESs: 100SectionCurrentDaySEFSs: 100SectionCurrentDayCVs: 5149776SectionCounterLOSs: 2SectionCounterLOFs: 2LineCurrentValidFlag: validLineCurrent15minTimeElapsed: 429sLineCurrentESs: 0LineCurrentSESs: 0LineCurrentCVs: 0LineCurrentUASs: 0FarEndLineCurrentValidFlag: validFarEndLineCurrent15minTimeElapsed: 429sFarEndLineCurrentESs: 0FarEndLineCurrentSESs: 0FarEndLineCurrentCVs: 0FarEndLineCurrentFCs: 0FarEndLineCurrentUASs: 0FarEndLineCurrentDayValidFlag: validFarEndLineCurrentDayESs: 2FarEndLineCurrentDaySESs: 2FarEndLineCurrentDayCVs: 46FarEndLineCurrentDayFCs: 0FarEndLineCurrentDaySEFSs: 0LineCurrentDayValidFlag: validLineCurrentDayESs: 100LineCurrentDaySESs: 100LineCurrentDayCVs: 100LineCurrentDaySEFSs: 0LineCounterAISs: 2LineCounterRFIs: 0PathCurrentValidFlag: validPathCurrent15minTimeElapsed: 429sPathCurrentESs: 0spirit11.1.7.PXM.a >Example 1-176 Display alarms and counters for line 1 (E3) on the PXM
spirit11.1.7.PXM.a > dspalmcnt -e3 7.1LineNum: 1LCVCurrent: 0LCVLast15minBucket: 0LCVLast24hrBucket: 0LESCurrent: 0LESLast15minBucket: 0LESLast24hrBucket: 0LSESCurrent: 0LSESLast15minBucket: 0LSESLast24hrBucket: 0SEFSCurrent: 0SEFSLast15minBucket: 0SEFSLast24hrBucket: 0AISSCurrent: 0AISSLast15minBucket: 0AISSLast24hrBucket: 0UASCurrent: 572UASLast15minBucket: 900UASLast24hrBucket: 4496BIP8CVCurrent: 0BIP8CV15MinBucket: 0BIP8CV24HrBucket: 0BIP8ESCurrent: 0BIP8ES15MinBucket: 0BIP8ES24HrBucket: 0BIP8SESCurrent: 0BIP8SES15MinBucket: 0BIP8SES24HrBucket: 0PercentEFS: 100RcvLOSCount: 0RcvOOFCount: 0RcvRAICount: 0RcvCCVCount: 0RcvFECount: 0Example 1-177 Display alarms and counters for line 1 on the VISM
spirit.1.5.VISM8.a > dspalmcnt -ds1 1Line RcvLOSCount RcvOOFCount RcvRAICount RcvFECount---- ----------- ----------- ----------- ----------5.1 0 0 0 4095spirit.1.5.VISM8.a >Example 1-178 Display alarms and counters for line 1 on the FRSM-2T3
spirit.1.1.VHS2T3.a > dspalmcnt -ds3 1LineNum: 1LCVCurrent: 0LCVLast15minBucket: 0LCVLast24hrBucket: 0LESCurrent: 0LESLast15minBucket: 0LESLast24hrBucket: 0LSESCurrent: 0LSESLast15minBucket: 0LSESLast24hrBucket: 0PCVCurrent: 0PCVLast15minBucket: 0PCVLast24hrBucket: 0PESCurrent: 0PESLast15minBucket: 0PESLast24hrBucket: 0PSESCurrent: 0PSESLast15minBucket: 0PSESLast24hrBucket: 0CCVCurrent: 0CCVLast15minBucket: 0CCVLast24hrBucket: 0CESCurrent: 0CESLast15minBucket: 0CESLast24hrBucket: 0CSESCurrent: 0CSESLast15minBucket: 0CSESLast24hrBucket: 0SEFSCurrent: 0SEFSLast15minBucket: 0SEFSLast24hrBucket: 0AISSCurrent: 0AISSLast15minBucket: 0AISSLast24hrBucket: 0UASCurrent: 0UASLast15minBucket: 0UASLast24hrBucket: 0PercentEFS: 0RcvLOSCount: 0RcvOOFCount: 0RcvRAICount: 0RcvCCVCount: 0RcvFECount: 0spirit.1.1.VHS2T3.a >dspalms
Use the dspalms command to view all alarms for the selected line type on the card.
Full Name
Display All Alarms on a Card
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, SRM-3T3, CESM, VISM
Syntax for PXM, FRSM, AUSM, SRM-3T3, CESM, VISM
dspalms <lineType> <slot number>
Syntax Description
lineType
Line type.
•
•
•
•
•
slot number
Slot number = enter a value from the range 7, 8, 15, 16, 31, 32.
Enter the value either 7 or 8 for SONET.
Syntax for FRSM-HS1
dspalms -<lineType>
Syntax Description
Related Commands
dspalm
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples.
•
•
•
•
Example 1-179 Display alarms on the current FRSM (slot 17, in this case)
spirit.1.17.FRSM.a > dspalms -ds1Line AlarmState StatisticalAlarmState---- ----------- ---------------------17.1 Alarm(s) On No Statistical Alarms17.2 No Alarms No Statistical Alarms17.3 No Alarms No Statistical Alarms17.4 No Alarms No Statistical Alarms17.5 Alarm(s) On No Statistical Alarms17.6 No Alarms No Statistical Alarms17.7 No Alarms No Statistical Alarms17.8 No Alarms No Statistical Alarmsspirit.1.17.FRSM.a >Example 1-180 Display alarms on the 2 E3 lines on the current card (a PXM)
wilco.1.7.PXM.a > dspalms e3 7Line : 1AlarmState : XmtRAI,RcvLOSStatisticalAlarmState : UAS15minAlarm,UAS24hrAlarmLine : 2AlarmState : No AlarmsStatisticalAlarmState : No Statistical Alarmswilco.1.7.PXM.a >Example 1-181 Display alarms on the 3 E1 lines on the current card (a VISM)
spirit.1.5.VISM8.a > dspalms -ds1Line AlarmState StatisticalAlarmState---- ----------- ---------------------5.1 No Alarms No Statistical Alarms5.2 No Alarms No Statistical Alarms5.3 No Alarms No Statistical Alarmsspirit.1.5.VISM8.a >Example 1-182 Display alarms on the 2 T3 lines on the current card (an FRSM-2T3)
spirit.1.1.VHS2T3.a > dspalms -ds3Line AlarmState StatisticalAlarmState---- ----------- ---------------------1.1 No Alarms No Statistical Alarms1.2 No Alarms No Statistical Alarmsdspapscfg
Use the dspapscfg command to display more Automatic Protection Switching (APS) parameters. APS is a standard that provides a means for SONET line redundancy. APS involves switching between working (active) and protection (standby) SONET lines in the event of a hardware failure detected by the receiving end or by the far-end. This support only applies to PXM OC3 and PXM OC12 cards.
The 1.1.20 software release provides support for the SONET Linear APS 1+1 mode.
Full Name
Display APS Configuration
Card(s) on Which This Command Executes
PXM
Syntax
dspapscfg
Related Commands
addapsln, cnfapsln, , delapsln
Attributes
Log: No State: Any Privilege: AnyExample 1-183 Display the APS configuration on the current PXM
DENAME.1.7.PXM.a > dspapscfgSlotLine Type SFBER SDBER WTR Direc Revert------------------------------------------------------------------------------7.1&8.1 1+1_2 3 5 1 UNI NRVDENAME.1.7.PXM.a >Data Components
dspapsln
Use the dspapsln command to display the Automatic Protection Switching (APS) line status.
APS is a SONET switching mechanism that routes traffic from working lines to protect them in case of a line card failure or fiber cut.
Full Name
Display APS Line
Card(s) on Which This Command Executes
PXM
Syntax
dspapsln
Related Commands
addapsln, cnfapsln, dspapscfg, delapsln
Attributes
Log: No State: Active Privilege: AnyExample 1-184 Display the APS line on the current PXM
NODENAME.1.7.PXM.a > dspapslnSlotLine Type Act W_LINE P_LINE APS_ST CDType Dirc Revt LastUsrSwReq------------------------------------------------------------------------7.1&8.1 1+1_2 7.1 OK OK OK OC-12 UNI NRV NO_REQUESTNODENAME.1.7.PXM.a >Data Components
dspatmlncnf
Use the dspatmlncnf command to view the cell header configuration for the line. The display indicates NNI or UNI cell headers. The configuration is the result of cnfatmln execution. This command applies to stand-alone configurations of the MGX 8800 series switch.
Full Name
Display ATM Line Configuration
Card(s) on Which This Command Executes
PXM
Syntax
dspatmlncnf <line_num>
Syntax Description
Related Commands
cnfatmln, clratmlncnt
Attributes
Log: No State: Any Privilege: AnyExample 1-185 Display the line configuration for line 2 of PXM
wilco.1.7.PXM.a > dspatmlncnf 2lineNum atmLineInterfaceFormat----------------------------------2 NNIwilco.1.7.PXM.a >dspatmlncnt
Use the dspatmlncnt command to view the ATM cell counters for the specified line. The display shows the total number of cells received, the total number of cells transmitted, and the number of cells received with HEC errors. The configuration is the result of cnfatmlncnt execution. This command applies to stand-alone configurations of the MGX 8800 series switch.
Full Name
Display ATM Line Counters
Card(s) on Which This Command Executes
PXM
Syntax
dspatmlncnt <line_num>
Syntax Description
Related Commands
cnfatmln, clratmlncnt, clratmlncnts
Attributes
Log: No State: Any Privilege: AnyExample 1-186 Display the ATM line counters (total cells received, total cells transmitted, and number of cells received with HEC errors) for line 1 of the PXM
wilco.1.7.PXM.a > dspatmlncnt 1Line Number : 1Total Rcvd. Cells : 5214310Total Xmtd. Cells : 368687Rcvd. HEC Error Cells : 0wilco.1.7.PXM.a >dspbctype
Use the dspbctype command to display the current interface of the 12IN1 dual-personality back card. The back card can be configured with either a V.35 or an X.21 interface.
Full Name
Display Back Card Type
Card(s) on Which This Command Executes
FRSM-HS1B
Syntax
dspbctype
Related Commands
cnfbctype
Attributes
Log: No State: Any Privilege: AnyExample 1-187 Displaying the back card type on the current FRSM
man.1.14.FRSM.a > dspbctypeBackcard Personality: X.21dspbert
Use the dspbert command to view the current BERT configuration.
Full Name
Display BERT
Card(s) on Which This Command Executes
PXM
Syntax
dspbert <slot>
Syntax Description
Related Commands
cnfbert, modbert
Attributes
Log: No State: Active Privilege: Anydspcbclk
Use the dspcbclk command to display the current clock rate setting. Using this command, you can see which service modules are set for a high cell bus (CB) operating clock rate (42 MHz) or a low rate (21 MHz). Note that not all service modules can support a high CB clock rate.
Full Name
Display Cell Bus Clock
Card(s) on Which This Command Executes
FRSM_2CT3, FRSM_2T3, FRSM_2E3, FRSM_HS2, CESM_T3, CESM_E3, VISM_8T1, VISM_8E1, RPM (new), PXM
Syntax
dspcbclk
Related Commands
cnfcbclk
Attributes
Log: No State: Any Privilege: AnyExample 1-188 Display the current CB settings for the PXM1-OC3 module in slot 7
popeye12.1.7.PXM.a > dspcbclkCommand Executed :dspcbclkCellBus Rate (MHz) Slot-------------------------------CB1 21 1, 2CB2 42 3, 4CB3 21 5, 6CB4 21 17 - 22CB5 21 9, 10CB6 21 11, 12CB7 21 13, 14CB8 21 25 - 30dspcd
Use the dspcd command to view characteristics of the current card's hardware and firmware, and information on its status. Card characteristics include serial number and hardware and firmware revision levels. Status may include the reason for the last reset (FunctionModuleResetReason) and state of the integrated alarm (cardIntegratedAlarm), which can be useful in debugging the card or an MGX 8800 series switch, respectively. Some of the information is common to the version command display, but version shows boot code version in bold.
Full Name
Display Card
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
dspcd [slot number]
Syntax Description
Related Commands
dspcds, version
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples.
•
•
•
•
•
•
•
•
Example 1-189 dspcd on the current PXM
popeye3.1.8.PXM.a > dspcdModuleSlotNumber: 8FunctionModuleState: ActiveFunctionModuleType: PXM1-OC3FunctionModuleSerialNum: SBK02420044FunctionModuleHWRev: 09FunctionModuleFWRev: 1.1.01HiFunctionModuleResetReason: Reset From ShellLineModuleType: PXM-UILineModuleState: PresentSecondaryLineModuleType: MMF-4-155SecondaryLineModuleState: PresentmibVersionNumber: 0.0.00configChangeTypeBitMap: No changescardIntegratedAlarm: MajorcardMajorAlarmBitMap: Line AlarmcardMinorAlarmBitMap: Line Statistical Alarmpopeye3.1.8.PXM.a >Example 1-190 dspcd on the current FRSM-8T1
node1.1.4.FRSM.a > dspcdModuleSlotNumber: 3FunctionModuleState: ActiveFunctionModuleType: FRSM-8T1FunctionModuleSerialNum: 622758FunctionModuleHWRev: bbFunctionModuleFWRev: 5.0.00akFunctionModuleResetReason: Power resetLineModuleType: LM-RJ48-8T1LineModuleState: PresentmibVersionNumber: 20configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: Clearfab number: 282069-01node1.1.4.FRSM.a >Example 1-191 dspcd on the current FRSM-2CT3
spirit.1.17.FRSM.a > dspcdModuleSlotNumber: 3FunctionModuleState: ActiveFunctionModuleType: FRSM-2CT3FunctionModuleSerialNum: CAB024804K8FunctionModuleHWRev: exFunctionModuleFWRev: 5.0.00_11Jan99_1_ttiFunctionModuleResetReason: Reset by ASC from Cell BusLineModuleType: LM-BNC-2T3LineModuleState: PresentmibVersionNumber: 20configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: Clearpcb part no-(800 level): 800-02910-04pcb part no-(73 level): 73-02265-04spirit.1.17.FRSM.a >Example 1-192 dspcd on the current FRSM-8E1
ModuleSlotNumber: 3FunctionModuleState: ActiveFunctionModuleType: FRSM-8E1FunctionModuleSerialNum: 782908FunctionModuleHWRev: abFunctionModuleFWRev: 5.0.00_21Dec98FunctionModuleResetReason: Power resetLineModuleType: LM-RJ48-8E1LineModuleState: PresentmibVersionNumber: 20configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: MajorcardMajorAlarmBitMap: Line AlarmcardMinorAlarmBitMap: Channel failurefab number: 28-2069-02Example 1-193 dspcd on the current CESM-8T1
ModuleSlotNumber: 1FunctionModuleState: ActiveFunctionModuleType: CESM-8T1FunctionModuleSerialNum: 786327FunctionModuleHWRev: abFunctionModuleFWRev: 5.0.00bqFunctionModuleResetReason: Reset by ASC from Cell BusLineModuleType: LM-RJ48-8T1LineModuleState: PresentmibVersionNumber: 20configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: MajorcardMajorAlarmBitMap: Line AlarmcardMinorAlarmBitMap: Channel failurefab number: 28-2199-02Example 1-194 dspcd on the current AUSM-8T1
spirit.1.19.AUSM8.a > dspcdModuleSlotNumber: 14FunctionModuleState: ActiveFunctionModuleType: AUSM-8T1FunctionModuleSerialNum: FNTYPEFunctionModuleHWRev: fkFunctionModuleFWRev: model-A 2.0.00FunctionModuleResetReason: Reset by PXM from PIOLineModuleType: LM-DB15-8T1LineModuleState: PresentmibVersionNumber: 4configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: MinorcardMinorAlarmBitMap: Channel failurespirit.1.19.AUSM8.a >Example 1-195 dspcd on the current VISM-8E1
spirit.1.5.VISM8.a > dspcdModuleSlotNumber: 5FunctionModuleState: ActiveFunctionModuleType: VISM-8E1FunctionModuleSerialNum: CAB0246014WFunctionModuleHWRev: 0.0FunctionModuleFWRev: rangarFunctionModuleResetReason: Power resetLineModuleType: LM-RJ48-8E1LineModuleState: PresentmibVersionNumber: 20configChangeTypeBitMap: CardCnfChng, LineCnfChngcardIntegratedAlarm: Clearpcb part no - (800 level): 800-04399-01pcb part no - (73 level): 73-03618-01Fab Part no - (28 level): 28-02791-01PCB Revision: 05Daughter Card Information:Daughter Card Serial Number: CAB024601FUpcb part no - (73 level): 73-03722-01Fab Part no - (28 level): 28-02905-01PCB Revision: 02spirit.1.5.VISM8.a >Example 1-196 dspcd on the current PXM (viewing the SRM-T3E3 in slot 15)
tinky.1.7.PXM.a > dspcd 15ModuleSlotNumber: 15FunctionModuleState: ActiveFunctionModuleType: SRM-3T3FunctionModuleSerialNum: 785324FunctionModuleHWRev: beFunctionModuleFWRev: 1.0.00FunctionModuleResetReason: Reset From ShellLineModuleType: LM-SRM-3T3LineModuleState: PresentSecondaryLineModuleType: MissingSecondaryLineModuleState: InvalidmibVersionNumber: 0.0.06configChangeTypeBitMap: No changescardIntegratedAlarm: ClearcardMajorAlarmBitMap: ClearcardMinorAlarmBitMap: Cleartinky.1.7.PXM.a >dspcderrs
Use the dspcderrs command to view information about card errors.
Full Name
Display Card Errors
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, VISM, CESM
Syntax
dspcderrs
Attributes
Log: No State: Any Privilege: AnyExample 1-197 Display card errors on the PXM module in slot 7
wilco.1.7.PXM.a > dspcderrsdspcderrs08/05/95-18:53:05 tRootTask 3 Task failed : scm09/05/95-09:14:08 tRootTask 3 Task failed : scmvalue = 0 = 0x0wilco.1.7.PXM.a >dspcdprtntype
Use the dspcdprtntype command to view partition type on the current card.
Full Name
Display Card Resource Type
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
dspcdprtntype
Related Commands
cnfcdprtntype
Attributes
Log: No State: Any Privilege: Any
Example 1-198 Display the card resource partition type on the current PXM
spirit.1.7.PXM.a > dspcdprtntypecardLcnPartitionType : controllerBasedspirit.1.7.PXM.a >dspcdrscprtn
Use the dspcdrscprtn command to view allocated resource information to a controller.
Note
Full Name
Display Card Resource Partition
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, VISM
Syntax
dspcdrscprtn
Related Commands
addcdrscprt
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
Example 1-199 Display the number of LCNs available for each of the three possible partitions on the current card (FRSM 2CT3)
spirit.1.13.VHS2CT3.a > dspcdrscprtnUser Status NumOfLcnAvail------ ------ -------------PAR Add 1000PNNI Add 1000TAG Add 1000spirit.1.13.VHS2CT3.a >Example 1-200 Display the number of LCNs available for each of the three possible partitions on the current card (CESM 8T1)
spirit.1.17.CESM.a > dspcdrscprtnUser Status NumOfLcnAvail------ ------ -------------PAR Mod 248PNNI Mod 248TAG Mod 248spirit.1.17.CESM.a >Example 1-201 Display the number of LCNs available for each of the three possible partitions on the current card (FRSM 8T1)
spirit.1.1.FRSM.a > dspcdrscprtnUser Status NumOfLcnAvail------ ------ -------------PAR Add 1000PNNI Add 1000TAG Add 1000spirit.1.1.FRSM.a >Example 1-202 Display the number of LCNs available for each of the three possible partitions on the current card (PXM T1)
spirit.1.7.PXM.a > dspcdrscprtnController Status Number of Available LCNs-----------------------------------------------PAR Enabled 32767PNNI Enabled 32767TAG Enabled 32767spirit.1.7.PXM.a >dspcds
Use the dspcds command to view the status of all the cards in the MGX 8800 series switch shelf.
Full Name
Display Card Shelf Information
Card(s) on Which This Command Executes
PXM
Syntax
dspcds
Related Commands
dspcd
Attributes
Log: No State: Active Privilege: AnyExample 1-203 Display all cards currently installed in the switch
wilco.1.7.PXM.a > dspcdsSlot CardState CardType CardAlarm Redundancy---- ----------- -------- --------- -----------1.1 Active FRSM-8T1 Major1.2 Empty Clear1.3 Active FRSM-2CT3 Clear1.4 Empty Clear1.5 Empty Clear1.6 Empty Clear1.7 Active PXM1-T3E3 Major1.8 Empty Clear1.9 Empty Clear1.10 Empty Clear1.11 Empty Clear1.12 Active RPM Clear1.13 Empty Clear1.14 Empty Clear1.15 Empty Clear1.16 Empty Clear1.17 Active CESM-8E1 Clear1.18 Empty Clear1.19 Empty Clear1.20 Empty Clear1.21 Empty Clear1.22 Empty Clear1.25 Empty Clear1.26 Empty Clear1.27 Empty Clear1.28 Empty Clear1.29 Empty Clear1.30 Empty Clear1.31 Empty Clear1.32 Empty ClearNumOfValidEntries: 32NodeName: wilcoDate: 02/01/1999Time: 07:32:41TimeZone: PSTTimeZoneGMTOff: -8StatsMasterIpAddress: 0.0.0.0shelfIntegratedAlarm: MajorBkplnSerialNum: 12345BkplnType: 2BkplnFabNumber: 73-0123-01BkplnHwRev: 80wilco.1.7.PXM.a >dspchan
Use the dspchan command to view a channel on a PXM, FRSM, VISM, AUSM, or CESM.
Full Name
Display Channel
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
dspchan <chan_num>
Syntax Description
chan_num
Channel number, as appropriate for the card.
•
•
•
•
Related Commands
dspchans, cnfchan
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
Example 1-204 Display the channel characteristics of channel 69 on an FRSM
spirit.1.17.FRSM.a > dspchan 69
ChanNum: 69ChanRowStatus: ModChanPortNum: 1ChanDLCI: 100EgressQSelect: 1IngressQDepth: 65535IngressQDEThresh: 32768IngressQECNThresh: 65535EgressQDepth: 65535EgressQDEThresh: 32768EgressQECNThresh: 6553DETaggingEnable: DisabledCIR: 24000Bc: 5100Be: 5100IBS: 100ForeSightEnable: EnabledQIR: 260MIR: 62PIR: 500ChanLocalRemoteLpbkState: EnabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanType: NIWChanFECNmap: setEFCIzeroChanDEtoCLPmap: mapCLPChanCLPtoDEmap: mapDEChanFrConnType: PVCChanIngrPercentUtil: 100ChanEgrPercentUtil: 100ChanEgrSrvRate: 1536000ChanOvrSubOvrRide: EnabledChanLocalVpi: 0ChanLocalVci: 100ChanLocalNSAP: 535052494e543031000000000000000002000100ChanRemoteVpi: 10ChanRemoteVci: 134ChanRemoteNSAP: 535052494e543031000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: ATFRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 4000ChanConnMCR: 4000ChanConnPercentUti: 100ChanNumNextAvailable: 17spirit.1.17.FRSM.a >Example 1-205 Display the channel characteristics of channel 16 on an AUSM
spirit.1.19.AUSM8.a > dspchan 16ChanNum: 16RowStatus: DelConnectionType: VCCServiceType: CBRChanSvcFlag: PVCPortNum: 1VPI: 0VCI (For VCC): 0Local VPId(for VPC): 0EgressQNum: 0IngressQDepth(cells): 1000IngressDiscardOption: CLP hysterisisIngressFrameDiscardThreshold 1000IngressQCLPHigh(cells): 900IngressQCLPLow(cells): 800QCLPState: LOWIngressEfciThreshold(cells): 1000UPCEnable: EnabledPeakCellRate[0+1](cells/sec): 50CellDelayVariation[0+1]: 10000 (micro secs)PeakCellRate[0](cells/sec): 50CellDelayVariation[0]: 10000 (micro secs)SustainedCellRate(cells/sec): 50MaximumBurstSize(cells): 1000SCRPolicing: CLP[0]CLPTagEnable: EnabledFrameGCRAEnable: DisableForesightEnable: DisableInitialBurstSize(cells): 0ForeSightPeakCellRate(cells/sec): 50MinimumCellRate(cells/sec): 0InitialCellRate(cells/sec): 1LocalRemoteLpbkState: DisableChanTestType: No TestChanTestState: Not In ProgressChanRTDresult: 65535 msIngress percentage util: 100Egress percentage util : 100Egress Service Rate: 50LocalVpi: 0LocalVci: 0LocalNSAP: 5468697320697320612064756d6d79204e534150RemoteVpi: 0RemoteVci: 0RemoteNSAP: 5468697320697320612064756d6d79204e534150Mastership: SlaveVpcFlag: VccConnServiceType: CBRRoutingPriority: 1MaxCost: 255RestrictTrunkType: No RestrictionConnPCR: 50ConnMCR: 0ConnPercentUtil: 100ChanNumNextAvailable : 17Local VpId NextAvailable : 2spirit.1.19.AUSM8.a >Example 1-206 Display the channel characteristics of channel 32 on the current CESM
MGX-01.1.1.CESM.a > dspchan 32ChanNum: 32ChanRowStatus: AddChanLineNum: 1ChanMapVpi: 1ChanMapVci: 32ChanCBRService: structuredChanClockMode: SynchronousChanCAS: BasicChanPartialFill: 47ChanMaxBufSize: 6144 bytesChanCDV: 6000 micro secondsC L I P: 2500 millisecondsChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanPortNum 1ChanConnType PVCISDetType DetectionDisabledCondData 255CondSignalling 0ExtISTrig DisableIdleSupressionISIntgnPeriod 4095 secondsISSignallingCode 0OnHookCode 1ChanLocalVpi: 0ChanLocalVci: 1ChanLocalNSAP: 535052494e543031000000000000000001000100ChanRemoteVpi: 10ChanRemoteVci: 132ChanRemoteNSAP: 535052494e543031000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: CBRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 4128ChanConnMCR: 4128ChanConnPercentUtil: 100ChanNumNextAvailable: 32MGX-01.1.1.CESM.a >Example 1-207 Display the channel characteristics of channel 16 on the current PXM
MGX-01.1.7.PXM.a > dspchan 16bbChanCnfNum : 16bbChanRowStatus : 1bbChanConnType : 2bbChanServiceType : 1bbChanConnDesc : 0x828d4e30bbChanSvcFlag : 2bbChanSvcConnId : 0bbChanIfNum : 1bbChanVpi : 10bbChanVci : 134bbChanUpcEnable : 1bbChanUpcPCR : 50bbChanUpcCDVT : 10000bbChanUpcSCR : 0bbChanUpcMBS : 0bbChanGcra1Action : 1bbChanGcra2Action : 1bbChanEfciThreshold : 98304bbChanDiscardOption : 1bbChanFrmDiscardThreshold : 0bbChanClpHiThreshold : 0bbChanClpLoThreshold : 0bbChanCongstUpdateCode : 1bbChanMaxCellMemThreshold : 131072bbChanIngrPercentUtil : 100bbChanEgrPercentUtil : 100bbChanEgrSrvRate : 50bbChanOvrSubOvrRide : 2bbChanLocalVpi : 10bbChanLocalVci : 134bbChanLocalNsapAddr : 0x828d4a20bbChanRemoteVpi : 0bbChanRemoteVci : 100bbChanRemoteNsapAddr : 0x828d49f0bbChanMaster : 2bbChanRtePriority : 1bbChanMaxCost : 255bbChanRestrictTrkType : 1bbChanTestType : 3bbChanTestState : 4bbChanTestResult : 0bbChanTestTypeCPESide : 2bbChanTestStateCPESide : 4bbChanUpcSCRPolicing : 3bbConnVpcFlag : 2bbConnServiceType : 1bbConnPCR : 50bbConnSCR : 0bbConnPercentUtil : 100bbRemoteConnPCR : 50bbRemoteConnSCR : 0bbRemoteConnPercentUtil : 100MGX-01.1.7.PXM.a >Example 1-208 Display the channel characteristics of channel 37 on the current VISM
spirit.1.5.VISM8.a > dspchan 37ChanNum: 37ChanRowStatus: AddChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanPortNum: 1ChanPvcType: VoIPChanConnectionType: PVCChanLocalVpi: 0ChanLocalVci: 1ChanLocalNSAP: 4e4f44454e414d45000000000000000005000100ChanRemoteVpi: 58ChanRemoteVci: 59ChanRemoteNSAP: 4e4f44454e414d45000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: CBRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionType <CR> to continue, Q<CR> to stop:ChanConnPCR: 100000ChanConnPercentUtil: 100ChanNumNextAvailable: 34Syntax : dspchan "chan_num"channel number -- values : 32 - 255spirit.1.5.VISM8.a >dspchancnt
Use the dspchancnt command to view the contents of the statistical counters for a channel.
Full Name
Display Channel Counters
Card(s) on Which This Command Executes
PXM, FRSM, CESM
Syntax
dspchancnt <channel number>
Syntax Description
Syntax for AUSM
dspchancnt <port.VPI.VCI | ChanNum>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
ChanNum
Channel number, in the range 16-1015.
Related Commands
dspchstats
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
Example 1-209 Display the counters for channel 69 of the current FRSM
wilco.1.17.FRSM.a > dspchancnt 69ChanNum: 69ChanState: okayChanUpTime: 10186Tx Rx--------------- ---------------AbitState: Sending A=1 Receiving A=1ATMState: Not sending any state Not receiving any stateTotal Frames: 0 0Total Bytes: 0 0Frames DE: 0 0Bytes DE: 0 0Frames Discarded: 0 0Bytes Discarded: 0 0FramesDiscXceedQDepth: 0 0BytesDiscXceedQDepth: 0 0FramesDiscXceedDEThresh: 0 0Frames FECN: 0 0Frames BECN: 0 0FramesTagged FECN: 0 0FramesTagged BECN: 0 0KbpsAIR: 0 0FramesTaggedDE: 0 0BytesTaggedDE: 0 0RcvFramesDiscShelfAlarm: 0XmtFramesDiscPhyLayerFail: 0XmtFramesDiscCRCError: 0XmtFramesDiscReAssmFail: 0XmtFramesDiscSrcAbort: 0XmtFramesDuringLMIAlarm: 0XmtBytesDuringLMIAlarm: 0RcvFramesDiscUPC: 0XmtFramesInvalidCPIs: 0XmtFramesLengthViolations: 0XmtFramesOversizedSDUs: 0XmtFramesUnknownProtocols: 0RcvFramesUnknownProtocols: 0wilco.1.17.FRSM.a >Example 1-210 Display the counters for channel 16 of the current AUSM
wilco.1.19.AUSM.a > dspchancnt 16
ChanNum: 16ChannelState: ActiveChannelEgressRcvState: NormalChannelEgressXmitState: NormalChannelIngressRcvState: NormalChannelIngressXmtState: NormalChanInServiceSeconds: 1126725ChanIngressPeakQDepth(cells): 1ChanIngressReceiveCells: 41160574ChanIngressClpSetCells: 0ChanIngressEfciSetRcvCells: 0ChanIngressUpcClpSetCells: 0ChanIngressQfullDiscardCells: 1ChanIngressClpSetDiscardCells: 0ChanIngressTransmitCells: 41160574ChanShelfAlarmDiscardCells: 0Syntax : dspchancnt "chan_num"channel number—value ranging from 16 to 1015wilco.1.19.AUSM.a >Example 1-211 Display the counters for channel 32 of the current CESM-8E1
MGX-01.1.1.CESM.a > dspchancnt 32ChanNum: 32Chan State: alarmChan RCV ATM State: Receiving AIS OAMChan XMT ATM State: Sending AIS OAMCell Loss Status: Cell LossReassembled Cells: 0Generated Cells: 1134344Header Errors: 0Seqence Mismatches : 0Lost Cells: 0Channel Uptime (secs.) 277Signalling Status OffhookSyntax : dspchancnt "chan_num"channel number -- values : 32 - 279MGX-01.1.1.CESM.a >dspchanmap
Use the dspchanmap command to view interworking field mapping for a specified channel.
Full Name
Display Channel Map
Card(s) on Which This Command Executes
FRSM
Syntax
dspchanmap -chn <ChanNum>
Syntax Description
Related Commands
cnfchanmap
Attributes
Log: No State: Any Privilege: Anydspchans
Use the dspchans command to view all current channels on the card.
Full Name
Display Channels
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, PXM, VISM
Syntax
dspchans
Related Commands
dspchan, addchan, delchan
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples.
•
•
•
•
Example 1-212 Display the channels on the current FRSM
spirit.11.1.FRSM.a > dspchansDLCI Chan EQ I/EQDepth I/EQDEThre I/EECNThre Fst/DE Type Alarm------------- ---- -- ----- ----- ----- ----- ----- ----- --- --- ----- -----11.1.1.100 69 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.101 70 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.102 71 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.103 72 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.104 73 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.105 74 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.106 75 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.107 76 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.108 77 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.109 78 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.110 79 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.111 80 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.112 81 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.113 82 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.114 83 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.1.115 84 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW No11.1.2.100 85 1 65535/65535 32768/32768 65535/6553 Ena/Dis NIW Nospirit.11.1.FRSM.a >Example 1-213 Display the channels on the current PXM
wilco.1.7.PXM.a > dspchans
Chan Stat Intf locVpi locVci conTyp srvTyp PCR[0+1] Mst rmtVpi rmtVci State----------------------------------------------------------------------------16 Ena 1 10 134 VCC CBR 50 Slv 0 100 normal32 Ena 1 10 132 VCC CBR 50 Slv 0 1 alarmwilco.1.7.PXM.a >Example 1-214 Display the channels on the current VISM
spirit.1.5.VISM8.a > dspchansChannel ChanNum Status------------ ------- ------5.0.1.37 37 AddNumber of channels: 1ChanNumNextAvailable: 33Syntax : dspchansspirit.1.5.VISM8.a >Example 1-215 Display the channels on the current AUSM-8T1E1
s1.1.12.AUSMB8.a > dspchansChan Port.VPI.VCI ConnType Service Type PCR[0+1] Q-Depth State---- ------------ ------- ------------ --------- ------- -------21 2.1.1 VCC CBR 4528 1000 Active26 2.1.3 VCC VBR 4528 1000 Active31 2.1.5 VCC ABR 4528 1000 Alarm37 2.1.7 VCC UBR 4528 1000 Alarmdspchstats
Use the dspchstats command to view current statistics associated with the specified channel.
Full Name
Display Channel Statistics
Card(s) on Which This Command Executes
FRSM
Syntax
dspchstats <line>.<1stDS0>.<DLCI>
Syntax Description
line
Line number, in the range 1-8.
1stDS0
1st_DS0, in the range appropriate for the interface.
•
•
DLCI
Connection for which the statistics are to be displayed.
Related Commands
dspchan, dspchans
Attributes
Log: No State: Any Privilege: AnyExample 1-216 Display the counters for line 1, 1st_DS0 of 4, and DLCI of 1000 for the current FRSM
wilco.1.17.FRSM.a > dspchstats 1.4.1000
lineNum: 1Physical Port Num: 4Logical Port Num: 2ChanDLCI: 1000ChanNum: 1ChanState: okayChanUpTime: 10186Tx Rx--------------- ---------------AbitState: Sending A=1 Receiving A=1ATMState: Not sending any state Not receiving any stateTotal Frames: 0 0Total Bytes: 0 0Frames DE: 0 0Bytes DE: 0 0Frames Discarded: 0 0Bytes Discarded: 0 0FramesDiscXceedQDepth: 0 0BytesDiscXceedQDepth: 0 0FramesDiscXceedDEThresh: 0 0Frames FECN: 0 0Frames BECN: 0 0FramesTagged FECN: 0 0FramesTagged BECN: 0 0KbpsAIR: 0 0FramesTaggedDE: 0 0BytesTaggedDE: 0 0RcvFramesDiscShelfAlarm: 0XmtFramesDiscPhyLayerFail: 0XmtFramesDiscCRCError: 0XmtFramesDiscReAssmFail: 0XmtFramesDiscSrcAbort: 0XmtFramesDuringLMIAlarm: 0XmtBytesDuringLMIAlarm: 0RcvFramesDiscUPC: 0XmtFramesInvalidCPIs: 0XmtFramesLengthViolations: 0XmtFramesOversizedSDUs: 0XmtFramesUnknownProtocols: 0RcvFramesUnknownProtocols: 0wilco.1.17.FRSM.a >dspclkinfo
Use the dspclkinfo command to view detailed information about all the configured clock sources in the node.
Full Name
Display Clock Information
Card(s) on Which This Command Executes
PXM
Syntax
dspclkinfo
Related Commands
dspclksrc, cnfclksrc
Attributes
Log: No State: Active Privilege: 3Example 1-217 Display the detailed clock information for the MGX 8800 series shelf
spirit3.1.7.PXM.a > dspclkinfo****** Clock HW registers ********SEL_T1 = t1 SEL100 = ON SEL120 = ON SEL120 = ONNOEXTCLK = ONpriMuxClockSource = INTERNAL_OSCprevPriMuxClockSource = INTERNAL_OSCprimaryInbandClockSourceLineNum = 0secMuxClockSource = EXTERNAL_CLOCKprevSecMuxClockSource = EXTERNAL_CLOCKsecondaryInbandClockSourceLineNumber = 1currentClockSetReq = primarycurrentClockHwStat = primaryPreviousClockHwStat = internalextClockPresent = NoextClkConnectorType = RJ45extClkSrcImpedance = 100 OhmsInternal Clock Status=1, Primary Clock Status=1Secondary Clock Status=0, Last inband Clock State=0last Inband Clock state= 0, Last External Clock Present = 1spirit3.1.7.PXM.a >dspclksrc
Use the dspclksrc command to view all configured clock sources in the node.
Full Name
Display Clock Sources
Card(s) on Which This Command Executes
PXM
Syntax
dspclksrc
Related Commands
cnfclksrc
Attributes
Log: No State: Active Privilege: AnyExample 1-218 Display the current clock source for the MGX 8800 series shelf
spirit3.1.7.PXM.a > dspclksrcPrimaryClockSource: Internal OscillatorSecondaryClockSource: External T1/E1 from C.O.CurrentClockSource: Internal OscillatorClockSwitchState: NoChangeExtClkPresent: Not PresentExtClkSrcImpedance: 75 ohmsExtClkConnectorType: BNCspirit3.1.7.PXM.a >dspcon
Use the dspcon command to view configuration data for a connection.
Full Name
Display Connection
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
dspcon <port number> <connection number>
Syntax Description
port number
Port number, in the range 1-8.
connection number
Connection number, as appropriate for the card.
•
•
•
•
Related Commands
addcon, delcon, dspcons
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples.
•
•
•
Example 1-219 Display the connection parameters for channel 16 on a CESM
spirit3.1.22.CESM.a > dspcon 16
ChanNum: 16RowStatus: AddConnectionType: VCCServiceType: CBRPortNum: 1VPI: 10VCI: 100EgressQNum: 1IngressQDepth (cells): 100IngressQCLPHigh (cells): 70IngressQCLPLow (cells): 60IngressEfciThreshold (cells): 50CompliantCellDelayVariation (micro secs): 0CompliantInfoRate (cells/sec): 0InitialBurstSize (cells): 0MaxFrameSize (cells): 0PeakInformationRate (cells/sec) 1000CLPTagEnable: DisabledFrameGCRAEnable: Disabledspirit3.1.22.CESM.a >Example 1-220 Display the connection parameters for the connection on channel 51 (port 3, DLCI 500) on the current FRSM
spirit.1.3.FRSM.a > dspcon 3.500ChanNum: 51ChanRowStatus: ModChanPortNum: 3ChanDLCI: 500EgressQSelect: 2IngressQDepth: 65535IngressQDEThresh: 32768IngressQECNThresh: 6554EgressQDepth: 65535EgressQDEThresh: 32768EgressQECNThresh: 6554DETaggingEnable: DisabledCIR: 1024000Bc: 5100Be: 5100IBS: 100ForeSightEnable: EnabledQIR: 2666MIR: 2666PIR: 5333ChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanType: SIW-XlatChanFECNmap: setEFCIzeroChanDEtoCLPmap: mapCLPChanCLPtoDEmap: mapDEChanFrConnType: PVCChanIngrPercentUtil: 100ChanEgrPercentUtil: 100ChanEgrSrvRate: 1024000ChanOvrSubOvrRide: EnabledChanLocalVpi: 0ChanLocalVci: 500ChanLocalNSAP: 73776973735f7031000000000000910003000300ChanRemoteVpi: 3ChanRemoteVci: 14ChanRemoteNSAP: 73776973735f7031000000000000910000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: ATFRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 5333ChanConnMCR: 2666ChanConnPercentUti: 100ChanNumNextAvailable: 63spirit.1.3.FRSM.a >Example 1-221 Display the connection parameters for the connection on channel 37 on the current VISM
spirit.1.5.VISM8.a > dspcon 37ChanNum: 37ChanRowStatus: AddChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanPortNum: 1ChanPvcType: VoIPChanConnectionType: PVCChanLocalVpi: 0ChanLocalVci: 1ChanLocalNSAP: 4e4f44454e414d45000000000000000005000100ChanRemoteVpi: 58ChanRemoteVci: 59ChanRemoteNSAP: 4e4f44454e414d45000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: CBRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionType <CR> to continue, Q<CR> to stop:ChanConnPCR: 100000ChanConnPercentUtil: 100ChanNumNextAvailable: 36Syntax : dspcon "chan_num"channel number -- values : 32 - 255spirit.1.5.VISM8.a >dspconcnt
Use the dspconcnt command to view counter data for the specified connection.
Full Name
Display Connection Counters
Card(s) on Which This Command Executes
PXM
Syntax
dspconcnt <conn_id>
Syntax Description
conn_id
Connection identifier, in the format port.vpi.vci.
•
•
•
Related Commands
addcon, delcon, dspcon, dspcons
Attributes
Log: No State: Any Privilege: AnyExample 1-222 Display the connection counters for the connection on port 2 with a VPI of 39 and a VCI of 45 on the current PXM
spirit4.1.8.PXM.a > dspconcnt 2.39.45Channel Number : 17Channel State : alarmChannel Ingress State : alarmChannel Egress State : otherCLP=0 Rcvd. Cells : 0CLP=1 Rcvd. Cells : 0GCRA1 Non Conforming Cells : 0GCRA2 Non Conforming Cells : 0EOF Cells Rcvd. : 0CLP=0 Discard Cells : 0CLP=1 Discard Cells : 0Total Xmtd. Cells : 7253CLP=0 Xmtd. Cells : 0CLP=1 Xmtd. Cells : 10867CLP=0 Discard Cells to Port : 0CLP=1 Discard Cells to Port : 0spirit4.1.8.PXM.a >dspcons
Use the dspcons PAR command to view details of all connections on the current card.
Full Name
Display Connections
Card(s) on Which This Command Executes
PXM, FRSM, CESM, AUSM, VISM
Syntax
dspcons
Related Commands
dspcon, addcon, delcon
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-223 Display parameters for the connections on the current AUSM
spirit3.1.1.AUSM.a > dspconsChan Port.VPI.VCI ConnType Service Type PCRlot1 Q-Depth State30 1.10.100 VCC ABR 3622 2000 Active33 1.10.200 VPC CBR 3622 100 Alarmspirit3.1.1.AUSM.a >Example 1-224 Display parameters for the connections on the current VISM
spirit.1.5.VISM8.a > dspconsConnId ChanNum Status------------------- ------- ------spirit.5.1.0 37 AddChanNumNextAvailable: 35Syntax : dspconsspirit.1.5.VISM8.a >dspcurclk
Use the dspcurclk command to view the current clock source for the switch.
Full Name
Display Current Clock Source
Card(s) on Which This Command Executes
PXM
Syntax
dspcurclk
Related Commands
dspclksrc, cnfclksrc, dspclkinfo
Attributes
Log: No State: Active Privilege: AnyExample 1-225 Display the current clock source for the connections on the current PXM
spirit4.1.8.PXM.a > dspcurclkCurrent Clock Source----------------------Source Node: spirit4Clock Level: --Clock Type : INTERNALspirit4.1.8.PXM.a >dspdsx3bert
Use the dspdsx3bert command to view parameters and results of the current BERT testing session.
Full Name
Display DSX3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax
dspdsx3bert
Attributes
Log: No State: Active Privilege: Any
Example 1-226
popeye1.1.21.CESMT3.a > dspdsx3bertBert Control: Acquire dsx3BertBert Resource Status State: In UseBert Owner: CLIBert Status: In SyncBert Test Medium: LineBert Port: 1Line Number : 1Bert Mode : bertPatternTestBert Pattern : allOnesLoopback type: metallicLoopbackStart time (secs.) Not Configured YetStart Date Not Configured YetBit countupper: 0Bit countlower: 0Bit Error Countupper 0Bit Error Countlower 0Error Insertion Rate: Error injection disabledError Insertion count: 0DSX3 BERT in SyncSyntax : dspdsx3bertpopeye1.1.21.CESMT3.a >dspegrq
Use the dspegrq command to view the port egress queue parameters. This command is valid only when the egress quality of service feature is enabled.
Full Name
Display Egress Queue Parameters
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
dspegrqs, dspegrservtype, cnfegrservtype
Attributes
Log: No State: Active Privilege: Any
Example 1-227 Display the port egress queue parameters for port 1
golden1.1.1.VHS2CT3.a > dspegrq 1 1ServicePortNum: 1Serv Type: 1Queue Depth: 65535Queue ECN Threshold: 6553Queue DE Threshold: 32767Max Bandwidth Increment: 16384portBytesDiscXceedQueFull: 0portBytesDiscXceedDEThresh:0golden1.1.1.VHS2CT3.a >dspegrqs
Use the dspegrqs command to view the egress queue parameters for all the ports on a shelf. This command is valid only when the egress quality of service feature is enabled.
Full Name
Display Egress Queue Parameters
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
dspegrq, dspegrservtype, cnfegrservtype
Attributes
Log: No State: Active Privilege: Any
Example 1-228 Display the egress queue parameters for a shelf
golden1.1.1.VHS2CT3.a > dspegrqs 1PortNum ServType Q Depth Q-ECN-Thres Q-DE-Thres BandWidth-Inc------- -------- ------- ----------- ---------- ---------1 1 65535 6553 32767 163841 2 65535 6553 32767 01 3 65535 6553 32767 01 4 65535 6553 32767 0golden1.1.1.VHS2CT3.a >dspegrservtype
Use the dspegrservtype to display the current egress port queue servicing.
Software Version
Command available with 1.1.20 and higher
Full Name
Display Egress Servicing Type
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
dspegrservtype
Attributes
Log: No State: Active Privilege: Any
dspenetgw
Use the dspenetgw command to display the permanent Ethernet gateway. The Ethernet gateway is specified with the cnfenetgw command.
Software Version
Command available with 1.1.20 and higher.
Full Name
Display Ethernet Gateway
Card(s) on Which This Command Executes
PXM
Syntax
dspenetgw
Related Commands
cnfenetgw
Attributes
Log: No State: Any Privilege: Any
Example 1-229 Display the default gateway
spirit3.1.7.PXM.a > dspenetgwspirit3.1.7.PXM.a > enet gateway: 172.29.37.1dsperr
Use the dsperr command to view the contents of either all error log files or a specific error log file.
Full Name
Display Errors
Card(s) on Which This Command Executes
PXM
Syntax
dsperr [-en <error slot>]
Syntax Description
-en
Command delineator that precedes the error slot entry.
error slot
Number of the error log file (optional).
Attributes
Log: No State: Any Privilege: Any
Examples
This section contains the following examples:
•
•
Example 1-230 Display all error log files. The output appears one screen at a time. A prompt appears at the bottom of the screen requesting you to continue to the next screen or quit
spirit3.1.7.PXM.a > dsperr----------Stack Trace:0x801e5714 vxTaskEntry + c: sysTaskSetup()0x80024d2c sysTaskSetup + 58: rmm_main()0x800dff7c rmm_main +624: rmm_process_message()0x800df764 rmm_process_message + 98: rmm_delete_seat()0x800e0f54 rmm_delete_seat + ac: ipc_remove_seat()0x800d1140 ipc_remove_seat + 50: ipc_renumber_as_slave()0x800d0a10 ipc_renumber_as_slave +208: my_free()0x800d3430 my_free + 8: ssiFree()0x8001c378 ssiFree + 8c: ssiEvent()0x800274dc ssiEvent +11c: ssiEvent()0x800277bc ssiEvent +3fc: sysStackTrace()----------No Dump Trace before the event----------No Dump Trace after the eventType <CR> to continue, Q<CR> to stop:----------Stack Trace:0x801e5714 vxTaskEntry + c: sysTaskSetup()0x80024d2c sysTaskSetup + 58: rmm_main()0x800dff7c rmm_main +624: rmm_process_message()0x800df764 rmm_process_message + 98: rmm_delete_seat()0x800e0f54 rmm_delete_seat + ac: ipc_remove_seat()0x800d1140 ipc_remove_seat + 50: ipc_renumber_as_slave()0x800d0a10 ipc_renumber_as_slave +208: my_free()0x800d3430 my_free + 8: ssiFree()0x8001c378 ssiFree + 8c: ssiEvent()0x800274dc ssiEvent +11c: ssiEvent()0x800277bc ssiEvent +3fc: sysStackTrace()----------No Dump Trace before the event----------No Dump Trace after the eventspirit3.1.7.PXM.a >Example 1-231 Display the error log for the card in slot 3. In this example, the card is an FRSM-8T1
spirit3.1.7.PXM.a > dsperr -en 3Stack Trace:0x801e5714 vxTaskEntry + c: sysTaskSetup()0x80024d2c sysTaskSetup + 58: rmm_main()0x800dff7c rmm_main +624: rmm_process_message()0x800df764 rmm_process_message + 98: rmm_delete_seat()0x800e0f54 rmm_delete_seat + ac: ipc_remove_seat()0x800d1140 ipc_remove_seat + 50: ipc_renumber_as_slave()0x800d0a08 ipc_renumber_as_slave +200: ipc_remove_ports_on_seat()0x800d02a8 ipc_remove_ports_on_seat + a0: ipc_remove_port()0x800d01dc ipc_remove_port +190: ipc_subsys_init()0x800cecf0 ipc_subsys_init +204: my_free()0x800d3430 my_free + 8: ssiFree()0x8001c378 ssiFree + 8c: ssiEvent()0x800274dc ssiEvent +11c: ssiEvent()0x800277bc ssiEvent +3fc: sysStackTrace()----------No Dump Trace before the event----------spirit3.1.7.PXM.a >dspfeature
Use the dspfeature command to display features or to change features, such as Channelized and Rate Control. Without parameters, this command acts as a display command.
When the rate control feature is set to ON, the card supports ForeSight. ForeSight is a software feature that provides a closed-loop feedback mechanism for controlling the rate at which users can apply to the network. It improves the efficiency of the network when carrying Frame Relay data, especially during periods of light usage, and maintains consistent performance during peak loading periods without dropping frames. This can be enabled only on an Available Bit Rate (ABR) connection. If the Rate Control feature is OFF, this cannot be enabled.
If the channelized feature is set to ON, it will enable either channelized E1 or channelized T1 for cards that are channelized.
FRSM-8T1
Channelized T1
FRSM-8E1
Channelized E1
FRSM-2CT3
Channelized T1
FRSM-2T3/2E3/HS2
No channelized feature on cards
Channelized E1 is an access link operating at 2.048 Mbps. It is subdivided into 30 B-channels and
1 D-channel, supporting DDR, Frame Realys, and x.25.Channelized T1 is an access link operating at 1.544 Mbps. It is subdivided into 24 channels
(23 B-channels and 1 D-channel) of 64 Kbps each. The individual channels or groups of channels connect to different destinations and support DDR, Frame Relay, and x.25. Channelized T1 also is known as fractional T1.Software Version
Command available with 1.1.20 and higher.
Full Name
Display Feature
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2), FRSM-8T1/E1
Syntax
dspfeature [[feature] [enable]]
Syntax Description
feature
One of the following features:
•
•
enable
Enable or disable feature:
•
•
Attributes
Log: No State: Any Privilege: Group -2
golden1.1.2.VHS2CT3.s > dspfeatureChannelized: OnRate Control: Ondspfst
Use the dspfst command to view current ForeSight parameter settings for the current service module. See the description of the cnffst command for an explanation of the ForeSight parameter settings.
Full Name
Display ForeSight Parameters
Card(s) on Which This Command Executes
FRSM
Syntax
dspfst
Related Commands
cnffst
Attributes
Log: Yes State: Active Privilege: 1-4Example 1-232 Display the current ForeSight parameter settings for the FRSM-2CT3
wilco.1.3.VHS2CT3.a > dspfstRateUp: 10 percentRateDown: 87 percentRateFastDown: 50 percentQIRTimeout: 10 secondsRTD: 5 secondswilco.1.3.VHS2CT3.a >dspfw
Use the dspfw command to view firmware files stored on the hard disk of the MGX 8800 series switch.
Full Name
Display Firmware Revisions
Card(s) on Which This Command Executes
PXM
Syntax
dspfw [bt] [sm <slot>]
Syntax Description
[bt]
Backup boot.
[sm <slot>]
Number of the service module slot that needs to be upgraded or downgraded.
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample 1-233 Show the firmware versions for the current PXM
raviraj.1.7.PXM.a > dspfwPXM FW versions:"1.1.10" in pxm_1.1.10.fw"1.1.11" in pxm_1.1.11.fwdspfwrevs
Use the dspfwrevs command to display the current list of firmware revisions on the PXM.
Full Name
Display Firmware Revisions
Card(s) on Which This Command Executes
PXM
Syntax
dspfwrevs
Related Commands
newrev, printrev
Attributes
Log: No State: Any Privilege: AnyExample 1-234 Show the current firmware revisions on the selected PXM.
raviraj.1.7.PXM.a > dspfwrevsIn dspfwrevs()Cfg Size Date Time File Name Card Type Version--- -------- ------------------ ------------ ------------ --------------------No 1996736 05/06/1999 15:40:24 pxm_gprasann.fw PXM1E1 gprasannNo 615232 05/10/1999 13:11:36 sm90.fw CESM-8T1E1 10.0.00_19Apr99_1No 794572 05/20/1999 18:10:50 sm35.fw FRSM-8T1E1 10.0.01_18May99_1_rmNo 1983308 04/24/1999 14:18:48 pxm_1.0.00Eh.fw PXM1E1 1.0.00EhN/A 1500292 04/28/1999 14:31:48 pxm_gprasann.fw.working-bcdc PXM1E1 gprasannNo 2089064 06/27/1999 08:12:50 pxm_rmenon.fw PXM1E1 rmenonYes 892356 07/01/1999 15:22:36 sm130.fw FRSM-2CT3E1 5.0.01_24Jun99_1_rajNo 884404 05/24/1999 11:30:04 smravi.fw FRSM-2CT3E1 5.0.00_21May99_1_rajraviraj.1.7.PXM.a >dsphotstandby
Use the dsphotstandby command to display service modules in hot standby state. Service modules that are part of a 1:1 redundancy can be in hot standby state. When the secondary service module is introduced, it goes into standby state for a number of minutes, then to hot standby state. For example, an FRSM-VHS module with 4000 connections requires about eight minutes to go from standby state to hot standby state.
In hot standby state, if the active service module fails, the standby service module takes over from the active service module with less than one second of traffic loss. Without the hot standby feature, the delay for a standby service module to take over could be as high as eight minutes, resulting in traffic loss for that period of time.
For the hot standby feature to work, you need a PXM and VHS image that support this functionality, and a FRSM-VHS module. This feature is available in the software version 1.1.20 release, and requires no configuration of the PXM or the service module.
Use dsphotstandby in conjunction with dspred to view the redundant slot links.
Full Name
Display Hot Standby
Card(s) on Which This Command Executes
PXM
Syntax
dsphotstandby
Related Commands
dspred
Attributes
Log: No State: Any Privilege: AnyExample 1-235 View the current redundant slot links
raviraj.1.7.PXM.a > dspredPrimary Primary Primary Secondary Secondary Secondary Red. Red.SlotSlotNum Type State SlotNum Type State Type Cover------- ------- ------- --------- --------- --------- ---- --------4 FRSM-2CT Standby 10 FRSM-2CT Active 1:1 4Example 1-236 Display the hot standby state for slots 4 and 10
raviraj.1.7.PXM.a > dsphotstandbySlot 4 : Primary SM in HOT STANDBY state.Slot 10 : Secondary Active SM.Example 1-237 Displaying a service module in slot 4 going from standby into hot standby state
raviraj.1.7.PXM.a > dsphotstandbySlot 4 : Primary SM not in Hot Standby state.Slot 10 : Secondary Active SM.dspif
Use the dspif command to view configuration and state information for a broadband interface.
Full Name
Display Interface
Card(s) on Which This Command Executes
PXM
Syntax
dspif <if_num>
Syntax Description
Related Commands
cnfif
Attributes
Log: No State: Any Privilege: AnyExample 1-238 Display configuration and state information for broadband interface number 1
spirit3.1.7.PXM.a > dspif 1ifNum Status Line ingrPctBw egrPctBw minVpi maxVpi------------------------------------------------------1 Ena 1 10 10 0 19spirit3.1.7.PXM.a >dspifcnt
Use the dspifcnt command to view interface counters for a broadband interface.
Full Name
Display Interface Counter
Card(s) on Which This Command Executes
PXM
Syntax
dspifcnt <if_num>
Syntax Description
Related Commands
cnfifcnt
Attributes
Log: No State: Any Privilege: AnyExample 1-239 Display counters and state information for broadband interface number 1
spirit3.1.7.PXM.a > dspifcnt 1Interface Num : 1Interface State : Line FailureTotal Cells : 0Received RM Cells : 0Received OAM Cells : 0Received CLP0 Cells : 0Received CLP1 Cells : 0Received CLP0,Discarded Cells : 0Received CLP1,Discarded Cells : 0Transmitted OAM Cells : 0Transmitted RM Cells : 0Transmitted CLP0 Cells : 0Transmitted CLP1 Cells : 0wilco.1.7.PXM.a >dspifip
Use the dspifip command to view all configured interface IP addresses on the current PXM, as well as their status. The possible interfaces are Ethernet, SLIP, and ATM. Data displayed for the SLIP interface will be displayed when the interface is enabled using the cnfifip command; for example:
cnfifip slip onSoftware Version
New feature (displays the state of each interface) available with 1.1.12 and higher.
Full Name
Display Interface IP Configuration
Card(s) on Which This Command Executes
PXM
Syntax
dspifip
Related Commands
cnfifip, delifip
Attributes
Log: No State: Any Privilege: Any
Example 1-240 Display the IP LAN configuration
spirit3.1.7.PXM.a > dspifipInterface Flag IP Address Subnetmask Broadcast Addr--------------- ---- --------------- --------------- ---------------Ethernet/lnPci0 UP 172.29.37.77 255.255.255.0 172.29.37.255SLIP/sl0 DOWN 172.29.36.253 255.255.255.252 (N/A)ATM/atm0 UP 192.9.200.1 255.255.255.128 0.0.0.0spirit3.1.7.PXM.a >dspifrsc
Use the dspifrsc command to view all resource partition information for the specified interface.
Full Name
Display Interface Resource Partition
Card(s) on Which This Command Executes
PXM
Syntax
dspifrsc <if_num>
Syntax Description
Related Commands
dspif
Attributes
Log: No State: Any Privilege: Any
Example 1-241 Display the resource partition information for all controller types on broadband interface 1
POP1.1.7.PXM.a > dspifrsc 1bbIfNum Ctrlr Status ingrPctBw egrPctBw minVpi maxVpi minVci maxVci maxChans-----------------------------------------------------------------------------1 PAR Mod 100 100 1 2000 0 65535 20001 PNNI Ena 100 100 1 2000 0 65535 327671 TAG Ena 100 100 1 2000 0 65535 327671 SVC Dis 0 0 0 0 0 0 0POP1.1.7.PXM.a >dspifs
Use the dspifs command to view the current list of configured broadband interfaces.
Full Name
Display List of Broadband Interfaces
Card(s) on Which This Command Executes
PXM
Syntax
dspifs
Related Commands
upif, cnfif
Attributes
Log: No State: Any Privilege: Any
Example 1-242 Display configuration and state information for all the broadband interfaces on the current PXM. In the response below, only broadband interface number 1 exists on the current PXM.
POP1.1.7.PXM.a > dspifsifNum Status Line ingrPctBw egrPctBw minVpi maxVpi------------------------------------------------------1 Ena 1 10 10 0 19POP1.1.7.PXM.a >dspilmi
Use the dspilmi command to view the interim local management interface (ILMI) configuration.
Full Name
Display ILMI
Card(s) on Which This Command Executes
PXM, AUSM
Syntax
dspilmi <port_num>
Syntax Description
Related Commands
cnfilmi, dspilmicnt
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-243 Display the ILMI configuration for port 1 on the AUSM
spirit3.1.20.AUSM.a > dspilmi 1Port Num: 1Signalling: No signallingSignallingVPI: 0SignallingVCI: 0ILMITrap: DisabledILMI-Min-Trap-Interval (secs): 1KeepAlivePolling: DisabledErrorThreshold: 3EventThreshold: 4PollingInterval (secs): 30MinimumEnquiryInterval (secs): 10EXT Operation: port 2spirit3.1.20.AUSM.a >Example 1-244 Display the ILMI configuration for port 1 on the PXM
spirit3.1.7.PXM.a > dspilmi 1Sig. Ilmi Sig Sig Ilmi T491 T492 T493 AddrPort State/Type Vpi Vci Trap/Int KA ErrTh/Pollint EvntTh EnqInt Reg.---- --------- ---- ---- -------- --- ------------- ------ ------ ----1 Off/none 0 16 Off/01 Off 3/v6 4 10 Offspirit3.1.7.PXM.a >dspilmicnt
Use the dspilmicnt command to view the ILMI counters.
Full Name
Display ILMI Counters
Card(s) on Which This Command Executes
PXM, AUSM
Syntax
dspilmicnt <port_num>
Syntax Description
Related Commands
cnfilmi, dspilmi
Attributes
Log: No State: Any Privilege: AnyExample 1-245 Display the ILMI counters for port 1 on the current AUSM card
spirit3.1.20.AUSM.a > dspilmicnt 1Port Num: 1SNMPPDUsReceived: 0Get RequestsReceived: 0GetNextRequestsReceived: 0SetRequestsReceived: 0TrapReceived: 0GetResponseReceived 0GetResponseTransmitted: 0GetRequestTransmitted: 0TrapsTransmitted: 0InvalidPDUReceived: 0Asn1ParseError: 0NoSuchNameError: 0TooBigError: 0spirit3.1.20.AUSM.a >dspilmis
Use the dspilmis command to view all interim local management interface (ILMI) configurations on the PXM.
Full Name
Display All ILMI Configurations
Card(s) on Which This Command Executes
PXM
Syntax
dspilmis
Related Commands
cnfilmi, dspilmi, dspilmicnt
Attributes
Log: No State: Any Privilege: AnyExample 1-246 Display the ILMI configuration for all ports on the PXM
spirit3.1.7.PXM.a > dspilmisSig. Ilmi Sig Sig Ilmi T491 T492 T493 AddrPort State/Type Vpi Vci Trap/Int KA ErrTh/Pollint EvntTh EnqInt Reg.---- --------- ---- ---- -------- --- ------------- ------ ------ ----1 Off/none 0 16 Off/01 Off 3/v6 4 10 Offspirit3.1.7.PXM.a >dspimagrp
Use the dspimagrp command to view delay and resilient links inverse multiplexing ATM (IMA) parameters on the current AUSM card.
Full Name
Display IMA Group
Card(s) on Which This Command Executes
AUSM
Syntax
dspimagrp <aimux_grp>
Syntax Description
Related Commands
cnfimagrp, dspimagrps, dspimagrpcnt
Attributes
Log: No State: Active Privilege: 1Example 1-247 Display all the detailed status and configuration information for AIMUX
group 1 on the current cardspirit.1.19.AUSM8.a > dspimagrp 1IMA Group number : 1Port type : NNILines configured : 1.2.3Enable : EnabledIMA Port state : Sig. FailureIMA Group Ne state : StartupPortSpeed (cells/sec) : 13470GroupTxAvailCellRate (cells/sec) : 0ImaGroupTxFrameLength(cells) : 128LcpDelayTolerance (IMA frames) : 1ReadPtrWrPtrDiff (cells) : 4Minimun number of links : 2MaxTolerableDiffDelay (msec) : 200Lines Present :ImaGroupRxImaId : 0x100ImaGroupTxImaId : 0x0Observed Diff delay (msec) : 0Clock Mode : CTCGroupAlpha : 2GroupBeta : 2GroupGamma : 1GroupConfiguration : 1IMAGrp Failure status : Ne StartUpTiming reference link : 1Syntax : dspimagrp (or dspaimgrp) "imagroup_number"IMA group number -- value ranging from 1 to 8spirit.1.19.AUSM8.a >dspimagrpcnt
Use the dspimagrpcnt command to view inverse multiplexing ATM (IMA) counters on the current AUSM card for all IMA groups.
Full Name
Display IMA Group Counters
Card(s) on Which This Command Executes
AUSM
Syntax
dspimagrpcnt <imagroup>
Syntax Description
Related Commands
dspimagrp, dspimagrpcnt, dspimagrps, dspimainfo, dspimalncnt
Attributes
Log: No State: Active Privilege: 1
Example 1-248 Display all the detailed status and configuration information for the IMA counters for AIMUX group 1 on the current card
spirit.1.19.AUSM8.a > dspimagrpcnt 1IMA Group number: 1Ne Number of failures : 0spirit.1.19.AUSM8.a >dspimagrps
Use the dspimagrps command to view inverse multiplexing ATM (IMA) parameters for AUSM.
Full Name
Display IMA Groups
Card(s) on Which This Command Executes
AUSM
Syntax
dspimagrps
Related Commands
dspimagrp, cnfimagrp, dspimainfo, dspimagrpcnt
Attributes
Log: No State: Active Privilege: 1Example 1-249 Display all the IMA parameter information for all AIMUX groups on the current card
spirit.1.19.AUSM8.a > dspimagrpsList of IMA groups:===================ImaGrp PortType Speed Lines configured Lines present Tol Diff Port StateDelay(ms)------ -------- ----- ---------------- ------------- --------- ----------19.1 NNI 13470 1.2.3 200 Sig. FailureNextPortNumAvailable: 8spirit.1.19.AUSM8.a >dspimainfo
Use the dspimainfo command to view information about inverse multiplexing ATM (IMA) parameters on the current AUSM card.
Full Name
Display AIM (or Display IMA) Information
Card(s) on Which This Command Executes
AUSM
Syntax
dspimainfo
Related Commands
dspimagrp, cnfimagrp
Attributes
Log: No State: Active Privilege: 1
Example 1-250 Display all the IMA parameter information for all AIMUX groups on the current card
spirit.1.19.AUSM8.a > dspimainfoLink NeTx NeRx TxId RxIDState State-----------------------------------------------------1 (null) (null) 0 02 (null) (null) 0 03 (null) (null) 0 04 (null) (null) 0 05 (null) (null) 0 06 (null) (null) 0 07 (null) (null) 0 08 (null) (null) 0 0spirit.1.19.AUSM8.a >dspimalncnt
Use the dspimalncnt command to view current AIMUX line counters for the specified line in an IMA trunk.
Full Name
Display AIM (or Display IMA) Line Count
Card(s) on Which This Command Executes
AUSM
Syntax
dspaimlncnt <imagroup> <linenum>
Syntax Description
Related Commands
clraimlncnt, clrimalncnt, dspaimlncnt
Attributes
Log: No State: Active Privilege: 1Example 1-251 Display the line counters for line 1 of IMA group 1
spirit.1.19.AUSM8.a > dspimalncnt 1 1IMA group number : 1Line number : 1Acp Cells Received : 0Acp Errored Cells Recvd : 0Port changed from LDS : 0# HEC errored cells : 0# HEC errored seconds : 0# Severely HEC errored seconds : 0Syntax : dspimalncnt (or dspaimlncnt) imagroup linenumIMA group number -- value ranging from 1 to 8line number -- value ranging from 1 to 8.spirit.1.19.AUSM8.a >dsplink
Use the dsplink command to view a link on a T3 line on an SRM-3T3 card.
Full Name
Display Link
Card(s) on Which This Command Executes
PXM
Syntax
dsplink <T3 line number>
Syntax Description
T3 line number
SRM-3T3 T3 line number, in the format slot.line.
•
•
Related Commands
dellink, addlink
Attributes
Log: No State: Active Privilege: 1System Response
dsplmiloop
Use the dsplmiloop command to view the current local management interface (LMI) configurations. The command displays the LMI loop status as present or not present for the feeder trunk. This command can be used only if a feeder trunk exists.
Full Name
Display LMI Loop
Card(s) on Which This Command Executes
PXM
Syntax
dsplmiloop
Related Commands
cnfilmi, dspilmi, dspilmicnt, dspilmis, addlmiloop, dellmiloop
Attributes
Log: No State: Any Privilege: AnyExamples
The example that follows illustrates:
1
2
Example 1-252 Display Feeder Trunk, Display LMI Loop
NAME.1.7.PXM.a > dsptrksTRK Current Alarm Status Other End7.1 CLEAR pswbpx1NODENAME.1.7.PXM.a > dsplmiloopTRK IN LMI LOOP-------------------7.1 NoThe example that follows illustrates:
1
2
Example 1-253 Add LMI Loop, Display LMI Loop
NODENAME.1.7.PXM.a > addlmiloop 7.1NODENAME.1.7.PXM.a > dsplmiloopTRK IN LMI LOOP-------------------7.1 Yesdsplmistats
Use the dsplmistats command to view the current local management interface (LMI) configurations.
Full Name
Display All LMI Statistics
Card(s) on Which This Command Executes
PXM
Syntax
dspilmis
Related Commands
cnfilmi, dspilmi, dspilmicnt, dspilmis
Attributes
Log: No State: Any Privilege: AnyExample 1-254 Display the LMI statistics for the PXM
spirit4.1.8.PXM.a > dsplmistatsEnabled : 1 Port Status : 0VPI.VCI : 3.31Polling enable : 1T393 : 10 N394 : 5T394 : 10 N395 : 5WaitStatus : 0 WaitStAck : 0Retry Timer : 0 Retry Count : 0Poll Timer : 0 Trans Num : 0Status Rx : 0 Status Tx : 0UpdtStatus Rx : 0 UpdtStatus Tx : 0Status Enq Rx : 0 Status Enq Tx : 0Status Ack Rx : 0 Status Ack Tx : 0NodeStatus Rx : 0 NodeStatus Tx : 18329NodeStaAck Rx : 0 NodeStaAck Tx : 0Bad PDU Rx : 0 Bad PDU Len Rx : 0Unknown PDU Rx : 0 Invalid I.E. Rx: 0Invalid Trans : 0BPX IP Addr : 172.1.1.215spirit4.1.8.PXM.a >dspln
Use the dspln command to view the characteristics of a specified physical line. When the current card is a PXM, you must specify the line type:
•
•
•
Full Name
Display Line
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: PXM
dspln <-ds3 | -e3 | -sonet> <LineNum>
Syntax Description
Note
Syntax: FRSM, AUSM, CESM, VISM
dspln <line_num>
Syntax Description
Related Commands
addln, cnfln, delln
Attributes
Log: No State: Active on PXM, any state on service modules Privilege: AnyExamples
This section contains the following examples.
•
•
•
•
Example 1-255 Display line 2 on the current AUSM card
spirit3.1.20.AUSM.a > dspln 2LineNum: 2LineConnectorType: BNCLineType: dsx1E1CASLineEnable: EnabledLineCoding: dsx1HDB3LineLength: G.703 75 ohmLineXmtClockSource: LocalTimingLineLoopbackCommand: NoLoopLineSendCode: NoCodeLineUsedTimeslotsBitMap: 0xffffffffConfigChangePortBitMap: 0x0LineNumOfValidEntries: 4spirit3.1.20.AUSM.a >Example 1-256 Display T3 line 1 on the current PXM (BNC-2T3)
spirit3.1.7.PXM.a > dspln -ds3 7.1LineNum: 1LineType: dsx3CbitParityLineCoding: dsx3B3ZSLineLength: lessThan225LineOOFCriteria: fBits3Of8LineAIScBitsCheck: Check C-bitsLineLoopbackCommand: NoLoopLineRcvFEACValidation: 4 out of 5 FEAC codesLineEnable: Disablespirit3.1.7.PXM.a >Example 1-257 Display OC-3 line 1 on the current PXM
spirit3.1.7.PXM.a > dspln -sonet 7.1
sonetLineNum: 1sonetLineType: sonetSts3csonetLineLoopback: NoLoopsonetHCSmasking: EnabledsonetPayloadScramble: EnabledsonetFrameScramble: EnabledsonetLineEnable: DisablesonetMediumType: sonetsonetMediumTimeElapsed: 0sonetMediumValidIntervals: 0sonetMediumLineCoding: NRZsonetMediumLineType: LongSingleModesonetMediumCircuitIdentifier: Sonet Linespirit.1.8.PXM.a >Example 1-258 Display line 3 on the current FRSM card
spirit3.1.3.FRSM.a > dspln 3LineNum: 3LineConnectorType: RJ-48LineType: dsx1E1CLEARLineEnable: EnabledLineCoding: dsx1HDB3LineLength: G.703 120 ohmLineXmtClockSource: LocalTimingLineLoopbackCommand: NoLoopLineSendCode: NoCodeLineUsedTimeslotsBitMap: 0xffffffffLineLoopbackCodeDetection: codeDetectDisabledLineBertEnable: DisableLineNumOfValidEntries: 8Syntax : dspln "line_num"line number -- values ranging from 1-8 are accepted, for FRSM_8spirit3.1.3.FRSM.a >dsplnrsc
Use the dsplnrsc command to view the resource partition information for a specified line on the PXM.
Full Name
Display Line Resource
Card(s) on Which This Command Executes
PXM
Syntax
dsplnrsc <line_num>
Syntax Description
Related Commands
addrscprtn, cnfrscprtn
Attributes
Log: No State: Any Privilege: Any
Example 1-259 Display partition information for line 1 on the current PXM
spirit.1.7.PXM.a > dsplnrsc 1ifNum Status Line ingrPctBw egrPctBw minVpi maxVpi------------------------------------------------------1 1 1 100 100 0 4095spirit.1.7.PXM.a >dsplns
Use the dsplns command to view the configuration for all lines on the current card. On the PXM, you must specify the line type.
Full Name
Display Lines
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
On all cards other than a PXM, enter dsplns without arguments.
On a PXM:
dsplns <LineTable> <slot>
Syntax Description
LineTable
Line type = enter ds3, or e3, or SONET.
Use the dspcd command to view line types.
slot
Slot number = enter a value from the range 7, 8, 15, 16, 31, or 32.
Related Commands
addln, cnfln, delln, dspcds, dspln
Attributes
Log: No State: PXM: Active. Others: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
•
•
Example 1-260 Display lines on the current FRSM (8T1) card
spirit3.1.3.FRSM.a > dsplnsLine Conn Type Status/Coding Length XmtClock Alarm StatsType Source Alarm---- ----- ------------ ------ -------- ------------- -------- ----- -----3.1 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.2 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.3 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.4 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.5 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.6 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.7 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim3.8 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTimspirit3.1.3.FRSM.a >Example 1-261 Display lines on the current FRSM HS1/B card
porky.1.14.FRSM.a > dsplnsLine Type Rate Status Alarm---- ------ ----------- -------- ---------14.1 dte 8192 Kbps mod Yes14.2 dce 8192 Kbps mod No14.3 dte 8192 Kbps mod Yes14.4 dte 48 Kbps disLineNumOfValidEntries: 4porky.1.14.FRSM.a >Example 1-262 Display lines on the current PXM with BNM-T3E3 trunk card
spirit3.1.7.PXM.a > dsplns ds3 7Line Type Coding Length Criteria AIScBitsCheck---- -------------- -------- ------------- ----------- -------------1 dsx3CbitParity Dis / dsx3B3ZS lessThan225 fBits3Of8 Check C-bits1 dsx3CbitParity Dis / dsx3B3ZS lessThan225 fBits3Of8 Check C-bitLineNumOfValidEntries: 1spirit3.1.7.PXM.a >Example 1-263 Display lines on the current AUSM
spirit3.1.19.AUSM.a > dsplnsMedium Medium Medium MediumΠLine Conn Type Status/Coding Length XmtClock Alarm StatsType Source Alarm---- ----- ------------ ------ -------- ------------- -------- ----- -----19.1 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.2 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.3 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.4 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.5 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.6 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.7 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTim19.8 SMB dsx1E1CCS Dis/dsx1HDB3 G.703 75 ohm LocalTimLineNumOfValidEntries: 8spirit3.1.19.AUSM.a >Example 1-264 Display lines on the PXM with OC-3
spirit.1.8.PXM.a > dsplns sonet 7Medium Medium Medium MediumSonet Line Line Line HCS Payload Frame Time Valid Line LineLine Type Status Lpbk mask Scramble Scramble Elapsed Intvls Coding Type----- ----- ------ ------ ---- -------- -------- ------- ------ ------ ------1 sonet Dis NoLoop Ena Enabled Enabled 0 0 NRZ LongSine2 sonet Dis NoLoop Ena Enabled Enabled 0 0 NRZ LongSine3 sonet Dis NoLoop Ena Enabled Enabled 0 0 NRZ LongSine4 sonet Dis NoLoop Ena Enabled Enabled 0 0 NRZ LongSinespirit.1.8.PXM.a >Example 1-265 Display lines on the PXM with OC-12
spirit3.1.7.PXM.a > dsplns sonet 7Medium Medium Medium MediumSonet Line Line Line HCS Payload Frame Time Valid Line LineLine Type Status Lpbk mask Scramble Scramble Elapsed Intvls Coding Type----- ----- ------ ------ ---- -------- -------- ------- ------ ------ ------1 sonet Ena NoLoop Ena Enabled Enabled 96734 96 Other LongSingleModespirit3.1.7.PXM.a >dsploads
Use the dsploads PAR command to view the connection load at a specified port on the AUSM. This command helps you to determine whether adding more connections is advisable.
The display shows the load in cells per second. The layout of the display is in rows and columns. One column exists for each port, and one row exists for each connection type. If the traffic is exceeding the bandwidth configured for the port, an "overload" message appears at the bottom of the column for the overloaded port.
Full Name
Display Loads
Card(s) on Which This Command Executes
AUSM
Syntax
dsploads
Related Commands
None
Attributes
Log: No State: Active Privilege: AnyExample 1-266 Display the load on the current AUSM
spirit3.1.20.AUSM.a > dsploadsLoad Display for AUSM portsPort 1 Port2 Port3 Port4*******************************CBR (based on PCR0+1) 0 0 0 0VBR (based on PCR0+1) 0 0 0 0ABR (based on MCR) 64000 64000 64000 64000-------------------------------Total 64000 64000 64000 64000Load Status OverloadOverloadOverloadOverloadNote: All Cell Rates are multiplied by respectivePercentage Utilization factorsspirit3.1.20.AUSM.a >dsplog
Use the dsplog command to view events and messages logged by the current PXM or FRSM. The most recent events appear at the top of the list. The dsplog command displays the MGX 8800 series log. If you enter the command without either of the optional parameters, the system displays the entire log for all cards. Optionally, you can display the log for a particular card or a particular log entry.
Full Name
Display Log
Card(s) on Which This Command Executes
PXM, FRSM
Syntax
dsplog -log <EventLog# > -mod <ModuleName> -sev <Severity#> -sl <Slot# > -task <TaskName>
-tge <MM/DD/YYYY-HH:MM:SS> -tle <MM/DD/YYYY -HH:MM:SS>Syntax Description
Related Commands
clrlog, dsplogs
Attributes
Log: No State: Any Privilege: AnyExample 1-267 Display all log files
spirit3.1.7.PXM.a > dsplogdsplog04/01/70-13:10:03 tRootTask 2 Illegal msg received04/01/70-13:10:07 aum 1312 local IP address not programmed03/01/70-20:11:31 smm 1207 slave ack timeoutspirit3.1.7.PXM.a >dsplogs
Use the dsplogs command to view information from all event log files.
Full Name
Display Logs
Card(s) on Which This Command Executes
PXM, FRSM
Syntax
dsplogs
Related Commands
clrlog, dsplog
Attributes
Log: No State: Any Privilege: AnyExample 1-268 Display all log files
spirit11.1.7.PXM.a > dsplogsspirit11.1.7.PXM.a > dsplogslog_file: C:/LOG/event04.logcreated when 11/08/1998-19:19:58error sequence # : 0log_file: C:/LOG/event03.logcreated when 11/04/1998-03:34:38error sequence # : 0log_file: C:/LOG/event02.logcreated when 11/04/1998-03:18:26error sequence # : 0log_file: C:/LOG/event01.logcreated when 11/04/1998-03:15:22error sequence # : 0spirit11.1.7.PXM.a >dspmaptbl
Use the dspmaptbl command to view the numbers assigned to Frame Relay ports or ATM ports on the FRSM or AUSM, respectively.
Full Name
Display Map Table
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
dspmaptbl
Related Commands
None
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-269 Display the map table for the current FRSM
spirit3.1.17.FRSM.a > dspmaptbl
PortNum DLCI ChanNum LineNum------- ---- ------- -------1 100 69 11 101 70 11 102 71 11 103 72 11 104 73 11 105 74 11 106 75 11 107 76 11 108 77 11 109 78 11 110 79 11 111 80 11 112 81 11 113 82 11 114 83 11 115 84 12 100 85 12 101 86 12 102 87 12 103 88 1spirit3.1.17.FRSM.a >Example 1-270 Display the map table for the current AUSM
spirit3.1.20.AUSM.a > dspmaptbl
PortNum VPI VCI ChanNum Channel Type------- --- --- ------- ------------1 1 16 16 VCC1 1 17 17 VCC1 1 18 18 VCC1 1 19 19 VCC1 1 20 20 VCC1 1 21 21 VCC1 1 22 22 VCC1 1 23 23 VCC1 1 24 24 VCC1 1 25 25 VCC1 1 26 26 VCC1 1 27 27 VCC1 1 28 28 VCC1 1 29 29 VCC1 1 30 30 VCC1 1 31 31 VCC1 1 32 32 VCC1 1 33 33 VCC1 1 34 34 VCC1 1 35 35 VCCspirit3.1.20.AUSM.a >dspmsgcnt
Use the dspmsgcnt command to view the control message counters for the card.
Full Name
Display Control Message Counters
Card(s) on Which This Command Executes
FRSM, AUSM, CESM, VISM
Syntax
dspmsgcnt
Related Commands
clrmsgcnt
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-271 Display the control message counters for the current card (an AUSM)
spirit.1.19.AUSM8.a > dspmsgcntRiscXmtCtrlMsg: 88006RiscRcvCtrlMsg: 53494SARXmtCtrlMsg: 88006SARRcvCtrlMsg: 53494SARCtrlMsgDiscLenErr: 0SARCtrlMsgDiscCRCErr: 0SARCtrlMsgDiscUnknownChan: 0SARCtrlMsgLastUnknownChan: 0spirit.1.19.AUSM8.a >Example 1-272 Display the control message counter for the current card (a VISM)
spirit.1.5.VISM8.a > dspmsgcntRiscXmtCtrlMsg: 83606RiscRcvCtrlMsg: 83606SARXmtCtrlMsg: 83445SARRcvCtrlMsg: 83606SARCtrlMsgDiscLenErr: 0SARCtrlMsgDiscCRCErr: 0SARCtrlMsgDiscUnknownChan: 0SARCtrlMsgLastUnknownChan: 0spirit.1.5.VISM8.a >dspname
Use the dspname PAR command to view the name of the node.
Full Name
Display Name
Card(s) on Which This Command Executes
PXM
Syntax
dspname
Attributes
Log: No State: Active Privilege: AnyExample 1-273
wilco.1.7.PXM.a > dspnameNode Name : wilcowilco.1.7.PXM.a >dspnwip
Use the dspnwip PAR command to view the network IP address for the switch.
Full Name
Display Network IP Address
Card(s) on Which This Command Executes
PXM
Syntax
dspnwip
Related Commands
cnfnwip
Attributes
Log: No State: Active Privilege: AnyExample 1-274 Display the network IP address for the switch
wilco.1.7.PXM.a > dspnwipNode IP : 192.0.0.0wilco.1.7.PXM.a >dspoamlpbk
Use the dspoamlpbk command to display the status of an OAM loopback test. The display indicates the PVCs currently under OAM loopback alarm, and the transmission rate of the OAM loopback cells.
Full Name
Display OAM Loopback
Card(s) on Which This Command Executes
FRSM 2T3/E3, FRSM HS2
Syntax
dspoamlpbk
Related Commands
cnfoamlpbk
Attributes
Log: No State: Any Privilege: AnyExample 1-275 Display loopback command without loopback configured on module
popeye1r.1.17.VHS2CT3.s > dspoamlpbkRasOamlpbkAllowedState: DisabledRasOamlpbkFrequency : 1Channels16 : 0000000000 0000000000 0000000000 000000000056 : 0000000000 0000000000 0000000000 000000000096 : 0000000000 0000000000 0000000000 0000000000136 : 0000000000 0000000000 0000000000 0000000000176 : 0000000000 0000000000 0000000000 0000000000216 : 0000000000 0000000000 0000000000 0000000000256 : 0000000000 0000000000 0000000000 0000000000296 : 0000000000 0000000000 0000000000 0000000000336 : 0000000000 0000000000 0000000000 0000000000376 : 0000000000 0000000000 0000000000 0000000000416 : 0000000000 0000000000 0000000000 0000000000456 : 0000000000 0000000000 0000000000 0000000000496 : 0000000000 0000000000 0000000000 0000000000536 : 0000000000 0000000000 0000000000 0000000000Example 1-276 Display loopback command with loopback configured on channels 17 and 18
popeye1r.1.17.VHS2CT3.a > dspoamlpbkRasOamlpbkAllowedState: EnabledRasOamlpbkFrequency : 2Following Channels are under Ras Alarm :Channels16 : 0000000000 0000000000 0000000000 000000000056 : 0000000000 0000000000 0000000000 000000000096 : 0000000000 0000000000 0000000000 0000000000136 : 0000000000 0000000000 0000000000 0000000000176 : 0000000000 0000000000 0000000000 0000000000216 : 0000000000 0000000000 0000000000 0000000000256 : 0000000000 0000000000 0000000000 0000000000296 : 0000000000 0000000000 0000000000 0000000000336 : 0000000000 0000000000 0000000000 0000000000376 : 0000000000 0000000000 0000000000 0000000000416 : 0000000000 0000000000 0000000000 0000000000456 : 0000000000 0000000000 0000000000 0000000000496 : 0000000000 0000000000 0000000000 0000000000536 : 0000000000 0000000000 0000000000 0000000000dsponoff
Use the dsponoff command to view all parameters activated by the onoff command for the current PXM.
Full Name
Display Onoff Command Settings
Card(s) on Which This Command Executes
PXM
Syntax
dsponoff
Related Commands
onoff
Attributes
Log: No State: Active Privilege: 2Example 1-277 Display all the parameters activated by the onoff command for the current PXM
spirit4.1.8.PXM.a > dsponoff1 Background Updates NO2 Dynamic BW Allocation YES3 Cm Updates YES4 Cm_Rerouting YES5 Comm Fail Test YES6 Deroute Delay YES7 Auto Renum Fail Recov YESspirit4.1.8.PXM.a >dspparifs
Use the dspparifs PAR command to view all Portable AutoRoute (PAR) interfaces for the current PXM.
Full Name
Display PAR Interfaces
Card(s) on Which This Command Executes
PXM
Syntax
dspparifs
Related Commands
None
Attributes
Log: No State: Active Privilege: AnyExample 1-278 Display all the PAR interfaces for the current PXM
spirit.1.7.PXM.a > dspparifsslot.port type status vpi vci txRate rxRae--------------------------------------------------------------------------------7.1 UNI_IF FAILED 0 to 4095 0 to 65535 96000 96000.33 CLK_IF FAILED 0 to 0 0 to 0 0 07.33 UNI_IF UP 0 to 255 0 to 65535 176604 176647.34 UNI_IF UP 0 to 255 0 to 65535 176604 17664spirit.1.7.PXM.a >dspplpp
Use the dspplpp command to view the configured Physical Layer Protocol Processor (PLPP) parameters on the current AUSM.
Full Name
Display PLPP
Card(s) on Which This Command Executes
AUSM
Syntax
dspplpp <port number>
Syntax Description
Related Commands
cnfplpp
Attributes
Log: Yes State: Active Privilege: 1Example 1-279 Display the PLPP parameters for port 1 on the current AUSM card
spirit.1.19.AUSM8.a > dspplpp 1PhysicalPortNumber: 1CellFraming: ATMCellScramble: ScramblePlpp Loopback: No LoopbackSingle-bit error correction: Disabledspirit.1.19.AUSM8.a >dspport
Use the dspport command on an FRSM and CESM to view the port configuration for the specified port.
Use the dspport command on an AUSM to view the Physical Layer Protocol Processor configuration for the specified port.
Full Name
Display Port
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
dspport <port number>
Syntax Description
port number
Port number, in the range appropriate for the card.
•
–
–
•
•
Related Commands
FRSM: addport, cnfport, delport
AUSM: upport, dnport
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-280 Display the port configuration for port 1 on the current FRSM8-T1
popeye.1.17.FRSM.a > dspport 1SlotNum: 17PortLineNum: 1PortNum: 1PortRowStatus: AddPortDs0Speed: 64kPortDs0ConfigBitMap(1stDS0): 0xffffff(1)PortEqueueServiceRatio: 1PortFlagsBetweenFrames: 1PortSpeed: 1536kbpsSignallingProtocolType: NoSignallingAsynchronousMsgs: UPD_UFS disabledT391LineIntegrityTimer: 10T392PollingVerificationTimer: 15N391FullStatusPollingCounter: 6N392ErrorThreshold: 3N393MonitoredEventCount: 4EnhancedLmi: OffPortState: ActivePortSignallingState: No Signalling FailureCLLMEnableStatus: DisableCLLMxmtStatusTimer: 0Type <CR> to continue, Q<CR> to stop:portType: frameRelayPortIngrPercentUtil: 0PortEgrPercentUtil: 0PortOversubscribed: FalsePortSvcStatus: DisablePortSvcInUse: Not In-UsePortSvcShareLcn: Card-basedPortSvcLcnLow: 0PortSvcLcnHigh: 0PortSvcDlciLow: 0PortSvcDlciHigh: 0PortDs0UsedLine1: 0x00ffffffPortDs0UsedLine2: 0x00ffffffPortDs0UsedLine3: 0x00ffffffPortDs0UsedLine4: 0x00000000PortDs0UsedLine5: 0x00000000PortDs0UsedLine6: 0x00000000PortDs0UsedLine7: 0x00000000PortDs0UsedLine8: 0x00000000PortNumNextAvailable: 31Example 1-281 Display normal UNI port on the current AUSM-8
popeye.1.29.AUSMB8.a > dspport 1LogicalPortNumber: 1Port Enable: UPPort State: Line alarmPortType: UNIPhysicalPortNumber: 1CellFraming: ATMCellScramble: ScramblePlpp Loopback: No LoopbackSingle-bit error correction: DisabledExample 1-282 Display a port in the IMA group on the current AUSM-8
popeye.1.27.AUSMB8.a > dspport 1 (or dspimagrp 1)IMA Group number : 1Port type : UNILines configured : 1.2.4Enable : EnabledIMA Port state : ActiveIMA Group Ne state : operationalPortSpeed (cells/sec) : 10773GroupTxAvailCellRate (cells/sec) : 7182ImaGroupTxFrameLength(cells) : 128LcpDelayTolerance (IMA frames) : 1ReadPtrWrPtrDiff (cells) : 4Minimun number of links : 2MaxTolerableDiffDelay (msec) : 275Lines Present : 1.2ImaGroupRxImaId : 0x0ImaGroupTxImaId : 0x0Observed Diff delay (msec) : 0Clock Mode : CTCGroupAlpha : 2GroupBeta : 2GroupGamma : 1GroupConfiguration : 1IMAGrp Failure status : No FailureTiming reference link : 1Example 1-283 Display port 1 on the current FRSM-VHS2CT3
golden.1.5.VHS2CT3.a > dspport 1SlotNum: 5PortLineNum: 1PortNum: 1PortRowStatus: AddPortDs0Speed: 64kPortDs0ConfigBitMap(1stDS0): 0xffffff(1)PortEqueueServiceRatio: n/aPortFlagsBetweenFrames: 0PortSpeed: 1536 kbpsSignallingProtocolType: NoSignallingAsynchronousMsgs: UPD_UFS disabledT391LineIntegrityTimer: 10 secT392PollingVerificationTimer:15 secN391FullStatusPollingCounter:6N392ErrorThreshold: 3N393MonitoredEventCount: 4EnhancedLmi: OffPortState: FailedDuetoLineFailurePortSignallingState: No Signalling FailureCLLMEnableStatus: DisableCLLMxmtStatusTimer: 40 msportType: frameRelayportEnhancedSIW: DisablePortIngrPercentUtil: 0PortEgrPercentUtil: 0PortOversubscribed: FalsePortSvcStatus: DisablePortSvcInUse: Not In-UsePortSvcShareLcn: Card-basedPortSvcLcnLow: 0PortSvcLcnHigh: 0PortSvcDlciLow: 0PortSvcDlciHigh: 0PortNumNextAvailable: 2Example 1-284 Display port 1 on the current FRSM-HS1
golden.1.25.FRSM.a > dspport 1SlotNum: 25PortNum: 1PortRowStatus: AddPortEqueueServiceRatio: 1PortFlagsBetweenFrames: 1PortSpeed: 48 KbpsSignallingProtocolType: NoSignallingAsynchronousUpdates: disT391LineIntegrityTimer: 10T392PollingVerificationTimer:15N391FullStatusPollingCounter:6N392ErrorThreshold: 3N393MonitoredEventCount: 4EnhancedLmi: OffPortState: FailedDuetoLineFailurePortSignallingState: No Signalling FailureCLLMEnableStatus: disCLLMxmtStatusTimer: 0portType: frameRelayPortIngrPercentUtil: 0PortEgrPercentUtil: 0PortOversubscribed: Falsedspportcnt
Use the dspportcnt command to view counters for a specified port.
Full Name
Display Port Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
dspportcnt <port number>
Syntax Description
Related Commands
cnfcd, dspcds
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
Example 1-285 Display port counters on port 1 of the current AUSM
spirit3.1.20.AUSM.a > dspportcnt 1
PortNum: 1PortState: Sig. FailureIngressRcvCells: 0IngressRcvCellRate (cells/sec): 0IngressRcvUtilization (percentage): 0IngressXmtCells: 0IngressGFCErrorCells: 0IngressVpiVciErrCells: 0IngressUnknownVpiVci: 0x0IngressRcvClpSetCells: 0EgressRcvCells: 0EgressRcvCellRate (cells/sec): 0EgressRcvUtilization (percentage): 0EgressXmtCells: 0EgressXmtCellRate (cells/sec): 0EgressXmtUtilization (percentage): 0EgressPortAlarmDiscardCells: 0EgressXmtClpSetCells: 0EgressXmtEfciSetCells: 0PortXmtAisCells: 0PortXmtSgmtLpbkCells: 0PortRcvAisCells: 0PortRcvFerfCells: 0PortRcvSgmtLpbkCells: 0PortRcvCrcErrOAMCells: 0TotalIngressQFullDiscardCells: 0TotalIngressClpSetDiscardCells: 0TransmitFIFOFullCount (per card): 0ReceivedHECErrorCells: 0HECErroredSeconds: 0SeverelyHECErroredSeconds: 0spirit3.1.20.AUSM.a >Example 1-286 Display port counters on port 1 of the current FRSM
spirit3.1.17.FRSM.a > dspportcnt 1
Tx Rx--------------- ---------------Total Frames: 0 0Total Bytes: 0 0Frames FECN: 0 0Frames BECN: 0 0Frames Abort: 0 0Buf Not Available: 0 0KbpsAIR: 0 0XmtFramesDiscXceedQDepth: 0XmtBytesDiscXceedQDepth: 0XmtFramesDuringLMIAlarm: 0XmtByteDuringLMIAlarm: 0XmtFramesUnderrun: 0RcvFramesDE: 0RcvFramesDiscCRCError: 0RcvFramesDiscIllegalHeader: 0RcvFramesDiscAlignmentError: 0RcvFramesDiscIllegalLen: 0RcvFramesDiscXceedDEThresh: 0RcvFramesUnknownDLCI: 0RcvLastUnknownDLCI: 0RcvFramesTaggedFECN: 0RcvFramesTaggedBECN: 0RcvFramesTaggedDE: 0Status: 0 0StatusInquiry: 0 0AsynchUpdate: 0 0RcvInvalidRequest: 0RcvUNISeqMismatch: 0RcvNNISeqMismatch: 0UNISignallingTimeout: 0NNISignallingTimeout: 0FramesCLLM: 0 0BytesCLLM: 0 0CLLMFailures: 0spirit3.1.17.FRSM.a >Example 1-287 Display port counters on port 1 of the current PXM
spirit4.1.8.PXM.a > dspportcnt 1Interface Num : 1Interface State : Line FailureTotal Cells : 0Received OAM Cells : 0Received RM Cells : 0Received CLP0 Cells : 0Received CLP1 Cells : 0Received CLP0,Discarded Cells : 0Received CLP1,Discarded Cells : 0Transmitted OAM Cells : 0Transmitted RM Cells : 0Transmitted CLP0 Cells : 256656Transmitted CLP1 Cells : 0spirit4.1.8.PXM.a >dspportq
Use the dspportq command to view queue information for a specified port and egress queue on the AUSM.
Full Name
Display Port Queue Information
Card(s) on Which This Command Executes
AUSM
Syntax
dspportq <port number> <egress queue number>
Syntax Description
port number
Port number, in the range 1-8.
egress queue number
Egress queue number, in the range 1-12.
Related Commands
dspportqs
Attributes
Log: No State: Any Privilege: AnyExample 1-288 Display queue information for egress queue 1 on port 1
spirit3.1.20.AUSM.a > dspportq 1 1
ServicePortNum: 1QueueNumber: 1PortBinState: DisableServiceSequence: 255QueueDepth(cells): 500CLPThresholdHigh(cells): 450CLPThresholdLow(cells): 400EFCIThreshold(cells): 400QueueAlgorithm: 255MaxBandwidthIncrement: 4096MinBandwidthIncrement: 0QCLPState: LowQFullDiscardedCells: 0CLPSetDiscardedCells: 0Syntax : dspportq "port_num egress_q"port number -- values ranging from 1-8queue # -- queue number : 1 - 16, 0 - for default in addchanspirit3.1.20.AUSM.a >dspportqs
Use the dspportqs command to view queue information for all the egress queues on an AUSM port.
Full Name
Display Port Queue Information
Card(s) on Which This Command Executes
AUSM
Syntax
dspportqs
Related Commands
dspportq
Attributes
Log: No State: Any Privilege: AnyExample 1-289 Display egress queue information for all the egress queues on the AUSM
spirit.1.19.AUSM8.a > dspportqsPort Q Num State Q-Algo Service-Seq Depth-Max CLP-High CLP-Low EFCI-Thrsh---- ----- ----- ------ ----------- --------- -------- ------- ----------1 1 Enabled 3 1 200 180 160 1601 2 Enabled 3 2 900 800 700 7001 3 Enabled 3 3 900 800 700 7004 1 Enabled 3 1 200 180 160 1604 2 Enabled 3 2 900 800 700 7004 3 Enabled 3 3 900 800 700 700Syntax : dspportqsdspportrscprtn
Use the dspportrscprtn command to view the port resource partition on the current PXM.
Full Name
Display Port Resource Partition Information
Card(s) on Which This Command Executes
PXM
Syntax
dspportrscprtn
Related Commands
dspcdrscprtn, dsplnrsc, dsprscprtn
Attributes
Log: No State: Any Privilege: AnyExample 1-290 Display the port resource partition on the current PXM
spirit4.1.8.PXM.a > dspportrscprtnPort Ctrlr Row PctBw VPI VCI MaxNum Type Stat In/Out min/max min/max GLCNs-------------------------------------------------------------1 PAR ON 100/100 0/255 0/65535 327671 PNNI ON 100/100 0/255 0/65535 327671 TAG ON 100/100 0/255 0/65535 327672 PAR ON 100/100 0/255 0/65535 327672 PNNI ON 100/100 0/255 0/65535 327672 TAG ON 100/100 0/255 0/65535 32767spirit4.1.8.PXM.a >dspports
Use the dspports command to view information about all ports on the current card.
Full Name
Display Ports
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
dspports
Related Commands
addport, cnfport, delport, dspport
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
Example 1-291 Display the ports on the current FRSM
spirit3.1.17.FRSM.a > dspports
Port Ena/Speed EQService SignalType T391 T392 N391 N392 N393 InAlarmRatio-------- --- ----- --------- ------------ ---- ---- ---- ---- ---- -------17.2.1 Add/1536k 1 NoSignalling 10 15 6 3 4 No17.2.2 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.3 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.4 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.5 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.6 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.7 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.8 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.9 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.10 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.11 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.12 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.13 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.14 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.15 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.16 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.17 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.18 Add/ 64k 1 NoSignalling 10 15 6 3 4 No17.2.19 Add/ 64k 1 NoSignalling 10 15 6 3 4 NoExample 1-292 Display the ports on the current PXM
pop_oc12.1.8.PXM.a > dspportsPort Status Line PctBw minVpi maxVpi------------------------------------------------------1 ON 1 100 0 40952 ON 2 100 0 4095Example 1-293 Display the ports on the current AUSM
spirit.1.19.AUSM8.a > dspportsNo ATM T1/E1 UNI ports currently activeList of IMA groups:===================ImaGrp PortType Speed Lines configured Lines present Tol Diff Port StateDelay(ms)------ -------- ----- ---------------- ------------- --------- ----------19.1 NNI 13470 1.2.3 200 Sig. FailureNextPortNumAvailable: 2spirit.1.19.AUSM8.a >Example 1-294 Display the ports on the current CESM
MGX-01.1.1.CESM.a > dspportsPort Ena/Speed Type------ --- ------ --------1.1.1 Add/1536k structurNumber of ports: 1PortDs0UsedLine1: 0x00ffffffPortDs0UsedLine2: 0x00000000PortDs0UsedLine3: 0x00000000PortDs0UsedLine4: 0x00000000PortDs0UsedLine5: 0x00000000PortDs0UsedLine6: 0x00000000PortDs0UsedLine7: 0x00000000PortDs0UsedLine8: 0x00000000PortNumNextAvailable: 10MGX-01.1.1.CESM.a >dspportstats
Use the dspportstats command to view statistics information for a specified port on the FRSM.
Full Name
Display Port Statistics
Card(s) on Which This Command Executes
FRSM
Syntax
dspportstats <line#> <1st_DS0>
Syntax Description
line#
Line number, in the range 1-8.
1st_DS0
First DS0, in the range appropriate for the interface.
•
•
Related Commands
dspchstats
Attributes
Log: No State: Any Privilege: AnyExample 1-295 Display statistics information for port 1 on first DS0 of 12
spirit3.1.17.FRSM.a > dspportstats 1 12
Line Num:1Physical Port Num: 12Logical Port Num: 4Tx Rx--------------- ---------------Total Frames: 0 0Total Bytes: 0 0Frames FECN: 0 0Frames BECN: 0 0Frames Abort: 0 0Buf Not Available: 0 0KbpsAIR: 0 0XmtFramesDiscXceedQDepth: 0XmtBytesDiscXceedQDepth: 0XmtFramesDuringLMIAlarm: 0XmtByteDuringLMIAlarm: 0XmtFramesUnderrun: 0RcvFramesDE: 0RcvFramesDiscCRCError: 0RcvFramesDiscIllegalHeader: 0RcvFramesDiscAlignmentError: 0RcvFramesDiscIllegalLen: 0RcvFramesDiscXceedDEThresh: 0RcvFramesUnknownDLCI: 0RcvLastUnknownDLCI: 0RcvFramesTaggedFECN: 0RcvFramesTaggedBECN: 0RcvFramesTaggedDE: 0Status: 0 0StatusInquiry: 0 0AsynchUpdate: 0 0RcvInvalidRequest: 0RcvUNISeqMismatch: 0RcvNNISeqMismatch: 0UNISignallingTimeout: 0NNISignallingTimeout: 0FramesCLLM: 0 0BytesCLLM: 0 0CLLMFailures: 0spirit3.1.17.FRSM.a >dspprf
Use the dspprf command to view profiler data. The profiler is organized in terms of resources that are being monitored. The data being collected for a particular resource can be of "interval" or "total" nature. If the total option is specified, the last 150 tasks executed, or that are executing, are displayed. If no options are specified, the dspprf command shows interval data. Note that the interval is configured using the cnfprfparam command.
If the abort option is added to the command, the latest profiler data that is saved during a Controller Card abort is displayed; for example, 1 million 3, 3 million, 2 million 1000, 52, 252. If the profiler is examined without the "abort" (a) option, then the real-time data that is being collected every "x" seconds (configured using cnfprfparam) is displayed. By default, the real-time data is collected every 20 seconds.
Full Name
Display Profiler Data
Card(s) on Which This Command Executes
PXM
Syntax
dspprf [t|i] [m|n|r]
Syntax Description
Related Commands
dspprfhist, cnfprfparm
Attributes
Log: No State: Active_Only Privilege: AnyAll valid combinations possible with the dspprf command are listed below. The [a] and [s] options specify abort or standby data.
dspprf i m
dspprf t m
dspprf i n
dspprf t n
dspprf i r
dspprf t r
Example 1-296 Interval profiler data for memory resources (dspprf i m)
NODENAME.1.7.PXM.a > dspprf i mHP LP Free AssgnINTERRUPT0 0 0 00 0 0 00 0 0 0UNKOWN0 0 0 00 0 0 00 0 0 0tRootTask0 0 0 00 0 0 00 0 0 0tLOGD2 0 2 02 0 2 02 0 2 0tSPM0 0 0 00 0 0 00 0 0 0tParRoot358 0 358 01000 0 1000 01000 0 1000 0tIpatm0 0 0 02 0 2 02 0 2 0tRVT0 0 0 00 0 0 00 0 0 0tCliAuthTra0 0 0 00 0 0 00 0 0 0tTnInTsk0128 0 28 01 0 2 020 0 20 0Data Components
Example 1-297 Total profiler data for memory resources (dspprf t m)
NODENAME.1.7.PXM.a > dspprf t mBlk Size MaxBlk MaxSzUNKOWN 204 24896 204 24896tRootTask 80 5129696 80 5129696tLOGD 1 80 2 160tSAR 0 0 0 0tSCM 201 19296 202 19376tRPC 2 144 5 400tDBM 201 192240 232 202656tDbmDisk 2 160 2 160tDbmRam 1 80 1 80tPMM 9 592 12 864tLDRV 7 459136 9 459312tOAM 0 0 1 16432tTFTPD 20 11200 20 11200tFILED 0 0 0 0tDbgInTask 8 3200 10 4512tTelnetD 2 304 6 27296tRed 7 576 10 1216992tRMM 2241 267712 2241 267712tAutoCard 4 272 7 672tVsmCMM 2 368 3 1216928tVsmConMgr 25 1808 26 18240tVsmIlmi 0 0 0 0BlkAssgn AssgnSz BlkFree FreeSz FailUNKOWN 0 0 0 0 0tRootTask 0 0 0 0 0tLOGD 0 0 2170 173600 0tSAR 0 0 0 0 0tSCM 7 560 2923 233840 0tRPC 2 176 18 1504 0tDBM 62 20832 121 33680 0tDbmDisk 0 0 0 0 0tDbmRam 0 0 0 0 0tPMM 6 544 5 432 0tLDRV 2 176 0 0 0tOAM 0 0 1 16432 0tTFTPD 0 0 0 0 0tFILED 0 0 0 0 0tDbgInTask 21 20032 21 18880 0tTelnetD 0 0 22 81632 0tRed 4 1219696 43274 5456384 0tRMM 0 0 0 0 0tAutoCard 1 176 2 224 0tVsmCMM 0 0 4 1216800 0tVsmConMgr 1 16432 0 0 0tVsmIlmi 0 0 0 0 0Data Components
Example 1-298 Interval profiler data for node resources (dspprf i n)
Displays statistics on the amount of SAR buffer used for messaging with other cards or nodes.
NODENAME.1.7.PXM.a > dspprf inFail HP LPCELL0 63 00 63 00 64 0SMALL0 1 00 27 00 27 0MEDIUM0 0 00 0 00 0 0LARGE0 0 00 0 00 0 0Pk Tx Low(APP->SCM)0 0 0Pk Tx High(APP->SCM)0 0 0Pk Rx Low(SAR->SCM)1 1 1Pk Rx High(SAR->SCM)0 0 0popftx43.1.8.PXM.a >Data Components
Example 1-299 Total profiler data for node resources (dspprf t n)
This command displays information about some of the node-wide resources. Currently, message buffers usage for messaging between different processes are stored.
NODENAME.1.7.PXM.a > dspprf tnPool Name: TotlChnk FreeChnk LoWatMk AllocOks AllcFail Frees---------------- -------- -------- -------- -------- -------- --------Nw_Prot_Pkt 100 100 100 0 0 0Nw_Msg_Ltr 1000 999 999 1 0 0Cm_SCon_Bmap 10 10 10 0 0 0Cm_Mcon_Bmap 10 9 9 1 0 0IPC port info 100 100 100 0 0 0Data Components
Example 1-300 Interval profiler data for region resources (dspprf i r)
NODENAME.1.7.PXM.a > dspprf irHP LP FailSTATIC Smple 0 21 0 0STATIC Smple -1 27 0 0STATIC Smple -2 22 0 0DYNAMIC Smple 0 1057 0 0DYNAMIC Smple -1 1057 0 0DYNAMIC Smple -2 1061 0 0STATISTC Smple 0 0 0 0STATISTC Smple -1 0 0 0STATISTC Smple -2 0 0 0Data Components
Example 1-301 Total profiler data for region resources (dspprf t r)
NODENAME.1.7.PXM.a > dspprf trAval FailSTATIC 34649040 0DYNAMIC 30099744 0STATISTIC 6078464 0Data Components
dspprfhist
Use the dspprfhist command to view performance history. The history maintains the real-time usage (historical) of all the tasks in the system. It can maintain 120 intervals worth of real-time data before it is overwritten. The actual time then depends on the interval time as configured by cnfprfparam 1 command (Interval Time). By default, the interval time is 20 seconds. Multiplied by 120 intervals, this would result in 120 * 20 = 2400 seconds of data. Therefore, you can display 2400 seconds of real-time usage by the different tasks in the system. Unlike the regular dspprf screens, this data is NOT saved on an abort.
This command is useful to determine the real-time usage after a particular event. For example, after a CC switchover or a CC rebuild, run dspprfhist to view how the real time was being used to recover from the rebuild or switchover.
Full Name
Display Performance History
Card(s) on Which This Command Executes
PXM
Syntax
dspprfhist [intervals]
Syntax Description
Related Commands
dspprf, cnfprfparm
Attributes
Log: No State: Active_Only Privilege: AnyExample 1-302 View two samples on the current PXM
NODENAME.1.7.PXM.a > dspprfhistCURRENT TIME 19:4:53Sample # 019:4:31(From)-19:4:51(To)TASK TaskId %---------------------------------------INTERRUPT - 0.2000KERNEL - 0.6000IDLE - 55.1000UNKOWN - 0.1000tSpmLmi 41 1.4500tBgndCheck 59 0.0500tTnCmdTsk01 84 42.2500tTnOutTsk01 85 0.2500Sample # -119:4:11(From)-19:4:31(To)TASK TaskId %---------------------------------------INTERRUPT - 0.2500KERNEL - 0.3500IDLE - 45.2000UNKOWN - 0.2500tSpmLmi 41 1.4500PAR:Lmi 53 0.0500PAR:Netw 56 0.0500tBgndCheck 59 0.0500tTnCmdTsk01 84 52.2500tTnOutTsk01 85 0.1000Sample # -219:3:51(From)-19:4:11(To)TASK TaskId %---------------------------------------INTERRUPT - 0.0000KERNEL - 0.0000IDLE - 98.6000UNKOWN - 0.0000tSpmLmi 41 1.4000Data Components
dspred
Use the dspred command to view the current redundant slot links.
Full Name
Display Redundancy
Card(s) on Which This Card Executes
PXM
Syntax
dspred
Related Commands
addred, delred
Attributes
Log: No State: Active Privilege: Any
Example 1-303 Display the current redundant slot links on the switch
spirit.1.7.PXM.a > dspredPrimary Primary Primary Secondary Secondary Secondary Red. Red.SlotSlotNum Type State SlotNum Type State Type Cover------- ------- ------- --------- --------- --------- ---- --------3 FRSM-8T1 Active 4 FRSM-8T1 Standby 1:N 0spirit.1.7.PXM.a >dsprscprtn
Use the dsprscprtn command to view the resource partition information for the specified interface.
Full Name
Display Resource Partition
Card(s) on Which This Command Executes
PXM
Syntax
dsprscprtn <if_num> <ctrlr_num>
Syntax Description
if_num
Interface Number, in the range 1-32.
ctrlr_num
Value to set controller type.
•
•
•
Related Commands
addrscprtn, cnfrscprtn
Attributes
Log: No State: Any Privilege: Any
Example 1-304 Display resource partition information for the PAR controller on broadband interface 1 on the current PXM
MGX-01.1.7.PXM.a > dsprscprtn 1 1bbIfNum Ctrlr Status ingrPctBw egrPctBw minVpi maxVpi minVci maxVci maxChans-----------------------------------------------------------------------------1 1 Ena 100 100 0 4095 0 65535 32767MGX-01.1.7.PXM.a >dsprscprtns
Use the dsprscprtns command to view the resource partition information for all the interfaces.
Full Name
Display Resource Partitions
Card(s) on Which This Command Executes
PXM
Syntax
dsprscprtns
Related Commands
addrscprtn, cnfrscprtn
Attributes
Log: No State: Any Privilege: Any
Example 1-305 Display resource partition information for all the broadband interfaces on the current PXM
MGX-01.1.7.PXM.a > dsprscprtnsbbIfNum Ctrlr Status ingrPctBw egrPctBw minVpi maxVpi minVci maxVci maxChans-----------------------------------------------------------------------------1 1 Ena 100 100 0 4095 0 65535 32767MGX-01.1.7.PXM.a >dspsarchans
Use the dspsarchans command to view the Segmentation and Reassembly (SAR) channels for the current card.
Full Name
Display SAR channels
Card(s) on Which This Command Executes
PXM
Syntax
dspsarchans
Related Commands
dspchans
Attributes
Log: No State: Any Privilege: AnyExample 1-306 Display SAR channels
penguin.1.7.PXM.a > dspsarchansGLCN SLOT LCN RX/TX------------------------------------------Intercard Channels:1 23 0 TX3 8 2 TX6 8 2 RX68 1 2 TX69 1 2 RX70 1 3 TX71 1 3 RX78 1 7 TX79 1 7 RX88 2 2 TX89 2 2 RX90 2 3 TX91 2 3 RX98 2 7 TX99 2 7 RX108 3 2 TX109 3 2 RX. . . .. . . .. . . .568 26 2 TX569 26 2 RX570 26 3 TX571 26 3 RX658 30 7 TX659 30 7 RXExternal Channels:GLCN IF VPI VCI RX/TX-------------------------------------------------720 1 3 31 RX721 1 3 8 RX32824 1 3 31 TX32825 1 3 8 TXpenguin.1.7.PXM.a >dspsarcnt
Use the dspsarcnt command to view the Segmentation and Reassembly (SAR) counters for the current card.
Full Name
Display SAR Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM-8T1E1, CESM, VISM
Syntax for PXM, FRSM, CESM, VISM
dspsarcnt <ChanNum>
Syntax Description
Syntax for AUSM-8T1E1
dspsarcnt <port.VPI.VCI | ChanNum>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
ChanNum
Channel number, in the range 16-1015.
Related Commands
dspsarcnts
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
Example 1-307 Display SAR count on the current CESM, channel 22
spirit3.1.13.CESM.a > dspsarcnt 22SarShelfNum: 1SarSlotNum: 13SarChanNum: 22Tx Rx--------------- ---------------Total Cells: 11227853 11529804Total CellsCLP: 0 0Total CellsAIS: 498805 0Total CellsFERF: 0 302222Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Syntax : dspsarcnt "chan_num"channel number—value ranging from 32 to 279possible errors are :a) illegal/invalid parametersb) channel doesn't existspirit3.1.13.CESM.a >Example 1-308 Display SAR count on the current FRSM, channel 17
wilco.1.1.FRSM.a > dspsarcnt 17SarShelfNum: 1SarSlotNum: 1SarChanNum: 17Tx Rx--------------- ---------------Total Cells: 0 0Total CellsCLP: 0 0Total CellsAIS: 3852 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Syntax : dspsarcnt "chan_num"channel number -- value ranging from 16 to 1015possible errors are :a) illegal/invalid parametersb) channel doesn't existwilco.1.1.FRSM.a >Example 1-309 Display SAR count for channel 98 on the current card (an AUSM)
spirit3.1.4.AUSM.a > dspsarcnt 98
SarShelfNum: 1SarSlotNum: 4SarChanNum: 98Tx Rx--------------- ---------------Total Cells: 141357 0Total CellsCLP: 0 0Total CellsAIS: 0 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0spirit3.1.4.AUSM.a >Example 1-310 Display SAR count for channel 37 on the current card (a VISM)
spirit.1.5.VISM8.a > dspsarcnt 37SarShelfNum: 1SarSlotNum: 5SarChanNum: 37Tx Rx--------------- ---------------Total Cells: 667605215 2717092629Total CellsCLP: 0 0Total CellsAIS: 2151235452 2150307780Total CellsFERF: 229 33554690Total CellsEnd2EndLpBk: 2150293128 15Total CellsSegmentLpBk: 50331906 2151235408RcvCellsDiscOAM: 2Syntax : dspsarcnt "chan_num"channel number -- values : 32 - 255possible errors are :a) illegal/invalid parametersb) channel doesn't existspirit.1.5.VISM8.a >dspsarcnts
Use the dspsarcnts command to view current segmentation and reassembly (SAR) counter values.
Full Name
Display SAR Counters
Card(s) on Which This Command Executes
PXM, FRSM, CESM
Syntax
dspsarcnts
Related Commands
dspsarcnt
Attributes
Log: No State: Any Privilege: AnyExample 1-311 Show the current SAR counts for the FRSM
wilco.1.1.FRSM.a > dspsarcntsSarShelfNum: 1SarSlotNum: 1SarChanNum: 0Tx Rx--------------- ---------------Total Cells: 0 0Total CellsCLP: 0 0Total CellsAIS: 0 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Type <CR> to continue, Q<CR> to stop:SarShelfNum: 1SarSlotNum: 1SarChanNum: 2Tx Rx--------------- ---------------Total Cells: 3912 9611Total CellsCLP: 0 0Total CellsAIS: 0 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Type <CR> to continue, Q<CR> to stop:SarShelfNum: 1SarSlotNum: 1SarChanNum: 3Tx Rx--------------- ---------------Total Cells: 0 0Total CellsCLP: 0 0Total CellsAIS: 0 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Type <CR> to continue, Q<CR> to stop:SarShelfNum: 1SarSlotNum: 1SarChanNum: 15Tx Rx--------------- ---------------Total Cells: 0 0Total CellsCLP: 0 0Total CellsAIS: 0 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0Type <CR> to continue, Q<CR> to stop:SarShelfNum: 1SarSlotNum: 1SarChanNum: 17Tx Rx--------------- ---------------Total Cells: 0 0Total CellsCLP: 0 0Total CellsAIS: 3952 0Total CellsFERF: 0 0Total CellsEnd2EndLpBk: 0 0Total CellsSegmentLpBk: 0 0RcvCellsDiscOAM: 0dspserialif
Use the dspserialif command to view the speed of a serial port.
Full Name
Display Serial Interface
Card(s) on Which This Command Executes
PXM
Syntax
dspserialif -if <serial_port_num>
Syntax Description
Attributes
Log: No State: Active Privilege: AnyExamples
Example 1-312 Display the speed setting on a console port
NODENAME.1.7.PXM.a > dspserialif -if 1
SerialPortNum : 1
SerialPortType : debug
SerialPortEnable : Enable
SerialPortBps : 9600bps
Example 1-313 Display the speed setting on a slip port
NODENAME.1.7.PXM.a > dspserialif -if 2
SerialPortNum : 2
SerialPortType : main
SerialPortEnable : Enable
SerialPortBps : 9600bps
dspservrate
Use the dspservrate command to view the service rate in cells per second on the selected channel.
Full Name
Display Service Rate
Card(s) on Which This Command Executes
FRSM
Syntax
dspservrate <ChanNum>
Syntax Description
ChanNum
Channel number, in the range appropriate for the interface.
•
•
•
•
Attributes
Log: No State: Any Privilege: AnyExample 1-314 Display the service rate on channel 22 on the current card
spirit3.1.17.FRSM.a > dspservrate 22Service Rate (cells/sec): 1000spirit3.1.17.FRSM.a >dspshelfalm
Use the dspshelfalm command to view the shelf alarms for the MGX 8800 series shelf. The status of every alarm appears in the display unless you include the optional argument and include a specific alarm number. See the example for the number for each alarm.
In the dspshelfalm display, the State column shows whether the alarm has been asserted. "Normal" means that no alarm has been asserted. If an alarm exists, State shows "Above Normal" or "Below Normal." The presence of the word "missing" in the State column means that the input is missing or ignored. The content of the Severity column indicates the severity of the alarm.
Full Name
Display Shelf Alarms
Card(s) on Which This Command Executes
PXM
Syntax
dspshelfalm [-alm <alarm number>]
Syntax Description
-alm
Command delineator that precedes the alarm number entry.
alarm number
Alarm number to display, in the range 1-27.
Related Commands
None
Attributes
Log: No State: Active Privilege: AnyExamples
This section contains the following examples.
•
•
Example 1-315 Display the status of all shelf alarms
spirit3.1.7.PXM.a > dspshelfalmmanish.1.7.PXM.a > dspshelfalmAlarm Type Unit Thresh Severity Measurable Val State----- ------------ ---- ------ -------- ---------- ----- -------1 Temperature 1 50 Minor Yes 28 Normal2 Power Supply 1 0 Minor No 0 Missing3 Power Supply 2 0 Minor No 0 Missing4 Power Supply 3 0 Minor No 0 Normal5 Power Supply 4 0 Minor No 0 Missing6 Power Supply 5 0 Minor No 0 Missing7 Power Supply 6 0 Minor No 0 Missing8 DC Level 1 6 Minor Yes 0 Below normal9 DC Level 2 6 Minor Yes 49 Normal10 Fan Unit 1 2000 Minor Yes 0 Missing11 Fan Unit 2 2000 Minor Yes 0 Missing12 Fan Unit 3 2000 Minor Yes 0 Missing13 Fan Unit 4 2000 Minor Yes 0 Missing14 Fan Unit 5 2000 Minor Yes 0 Missing15 Fan Unit 6 2000 Minor Yes 0 Missing16 Fan Unit 7 2000 Minor Yes 0 Missing17 Fan Unit 8 2000 Minor Yes 0 Missing18 Fan Unit 9 2000 Minor Yes 0 Missing19 Fan Unit 10 2000 Minor Yes 3582 Normal20 Fan Unit 11 2000 Minor Yes 3588 NormalType <CR> to continue, Q<CR> to stop:Alarm Type Unit Thresh Severity Measurable Val State----- ------------ ---- ------ -------- ---------- ----- -------21 Fan Unit 12 2000 Minor Yes 3666 Normal22 Fan Unit 13 2000 Minor Yes 3630 Normal23 Fan Unit 14 2000 Minor Yes 3528 Normal24 Fan Unit 15 2000 Minor Yes 3534 Normal25 Fan Unit 16 2000 Minor Yes 3498 Normal26 Fan Unit 17 2000 Minor Yes 3468 Normal27 Fan Unit 18 2000 Minor Yes 3420 NormalASMNumOfValidEntries: 27ASMShelfAlarmState: 2manish.1.7.PXM.a >Example 1-316 Display the status of shelf alarm 6
spirit3.1.7.PXM.a > dspshelfalm -alm 6Alarm Type Unit Thresh Severity Measurable Val State----- ------------ ---- ------ -------- ---------- --- -----6 Power Supply 4 ? Minor No 0 NormalASMNumOfValidEntries: 27ASMShelfAlarmState: 2spirit.1.7.PXM.a >dspslftst
Use the dspslftst command to view the self-test routine on the current card.
Full Name
Display Self-Test
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
dspslftst
Related Commands
clrslftst, cnfslftst, runslftstno
Attributes
Log: No State: Any Privilege: Any
Example 1-317 Display the self-test results for the switch
wilco.1.1.FRSM.a > dspslftstSelfTestEnable: EnabledSelfTestPeriod: 5SelfTestState: SelfTest PassedSelfTestResultDescription: No failure information availablewilco.1.1.FRSM.a >dspslftsttbl
Use the dspslftsttbl command to view the current contents of the self-test table.
Full Name
Display Self-Test Table
Card(s) on Which This Command Executes
FRSM
Syntax
dspslftsttbl
Related Commands
dspslftst
Attributes
Log: No State: Any Privilege: 1-6Example 1-318 Show current statistics for self-test table on the FRSM
wilco.1.3.VHS2CT3.a > dspslftsttblTest # Test Name Thold Fail Pass Last Enab Destr Card Rst1 CPU DRAM access test 1 0 0 P Y N Y2 SAR self test 1 0 0 P Y N Y3 ISE self test 1 0 0 P Y N Y4 ESE self test 1 0 0 P Y N Y5 CODE checksum test 1 0 0 P Y N Y6 Line loopback test 1 0 0 P Y Y Y7 FREEDM test 1 0 0 P Y Y Y8 Data loopback test 1 0 0 P Y Y Y9 CellBus test 1 0 0 P Y N Nwilco.1.3.VHS2CT3.a >dspslotlink
Use the dspslotlink command to view SRM-3T3 link information for all the lines on the specified service module slot.
Full Name
Display Slot Link
Card(s) on Which This Command Executes
PXM
Syntax
dspslotlink <slot number>
Syntax Description
Related Commands
delslotlink
Attributes
Log: No State: Active Privilege: 1Example 1-319 Display the SRM-3T3 link information for slot 1
spirit3.1.7.PXM.a > dspslotlink 1Slot Num : 1Max Lines : 0Link Counter: 0Slot Line# T3 Line# T1 Slot#==== ===== ======== =========1 1 0 01 2 0 01 3 0 01 4 0 01 5 0 01 6 0 01 7 0 01 8 0 0spirit3.1.7.PXM.a >dspsmcnf
Use the dspsmcnf command to view summaries of the configurations for service modules in the system.
Full Name
Display Service Module Configuration
Card(s) on Which This Command Executes
PXM
Syntax
dspsmcnf
Related Commands
clrsmcnf
Attributes
Log: Yes State: Active Privilege: AnyExample 1-320 Display the configuration of all the service modules in the switch
MGX 88003.1.3.PXM.a > dspsmcnfslot Card Rate Channel MIB FeatureNo. Type Control ized IMA MULTRKS Version Bits------ ---------- ------- ------- ------- ------- ------- -------1 ------> No configuration file exist for this slot <------2 ------> No configuration file exist for this slot <------3 FRSM-8T1 On On Off Off 20 0x34 FRSM-8T1 On On Off Off 20 0x35 ------> No configuration file exist for this slot <------6 ------> No configuration file exist for this slot <------9 ------> No configuration file exist for this slot <------10 ------> No configuration file exist for this slot <------11 ------> No configuration file exist for this slot <------12 ------> No configuration file exist for this slot <------13 ------> No configuration file exist for this slot <------14 ------> No configuration file exist for this slot <------17 ------> No configuration file exist for this slot <------18 ------> No configuration file exist for this slot <------19 ------> No configuration file exist for this slot <------20 FRSM-8E1 Off Off Off Off 20 0x021 ------> No configuration file exist for this slot <------22 ------> No configuration file exist for this slot <------25 ------> No configuration file exist for this slot <------26 ------> No configuration file exist for this slot <------27 ------> No configuration file exist for this slot <------28 ------> No configuration file exist for this slot <------29 ------> No configuration file exist for this slot <------30 ------> No configuration file exist for this slot <------dspsnmp
Use the dspsnmp command to view the community string configured on a service module.
Full Name
Display SNMP
Card(s) on Which This Command Executes
PXM
Syntax
dspsnmp
Related Commands
cnfsnmp
Attributes
Log: No State: Active Privilege: SuperUserExample 1-321 Display the SNMP community string
popeye.1.7.PXM.a > dspsnmpCommunity String :POPEYEdspsrmclksrc
Use the dspsrmclksrc command to view the SRM-3T3 clock source for a specified T3 line.
Full Name
Display SRM Clock Source
Card(s) on Which This Command Executes
PXM, SRM-3T3
Syntax
dspsrmclksrc -ds3 <T3 line number>
Syntax Description
-ds3
Command delineator for the T3 line number entry.
T3 line number
T3 line number is in the format slot.line.
•
•
Related Commands
cnfsrmclksrc
Attributes
Log: No State: Active Privilege: 1Example 1-322 Display the clock source for T3 line 1 on the SRM-3T3 in slot 15
spirit.1.7.PXM.a > dspsrmclksrc -ds3 15.1LineNum: 1LineXmtClockSource: backplane clock from BNMspirit.1.7.PXM.a >dspstatparms
Use the dspstatparms command to view statistics parameters on the current card.
Full Name
Display Statistics Parameters
Card(s) on Which This Command Executes
PXM, AUSM, CESM, FRSM
Syntax
dspstatparms
Attributes
Log: No State: Active Privilege: 1Example 1-323 Display statistics parameter settings on the current card (FRSM-2CT3)
wilco.1.3.VHS2CT3.a > dspstatparmsTFTP Retry Count: 1TFTP ACK time-out (sec): 60Bucket Interval: 0File Interval: 0Peak Enable Flag: DisabledObject Count: 0 STATS COLLECTION: DisabledObject Subtype Counts: 0 0 0 0Total File Memory Used: 0Number of File Allocated: 0Current File Size: 0Stat Memory Allocated: 0Auto Memory Allocated: 0Auto Mem Rgn Size: 6291456wilco.1.3.VHS2CT3.a >dspswfunc
Use the dspswfunc PAR command to view status of certain node-level, paid features on the node. The features are the feeder implementation (or default routing implementation) of the switch and virtual source/virtual destination (VSVD) control for ABR traffic.
Full Name
Display Software Function
Card(s) on Which This Command Executes
PXM
Syntax
dspswfunc
Related Commands
cnfswfunc
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-324 Display whether or not paid features (feeder implementation or default routing implementation) of the switch and VSVD control for ABR traffic) have been enabled
spirit.1.8.PXM.a > dspswfunc1. ABR VSVD(enable(yes)/disable(no): NO2. Node Type(routing(routing)/Feeder(fdr): ROUTINGspirit.1.8.PXM.a >dspsysparm
Use the dspsysparm command to view system parameters.
Full Name
Display System Parameters
Card(s) on Which This Command Executes
PXM
Syntax
dspsysparm
Related Commands
cnfsysparm
Attributes
Log: No State: Any Privilege: AnyExample 1-325 Display the system parameters for the node
spirit.1.8.PXM.a > dspsysparmMax Time Stamped Packet Age(msec) 32Fail Connections On Communication Break YESInterval Statistics polling rate for VCs 5Max Network Delay for 'v' connections(msec) 112Max Network Delay for 'c' connections(msec) 112Max Network Delay for 't' & 'p' connections(msec) 112Max Network Delay for 'a' connections(msec) 216Max Network Delay for High Speed Data connections(msec) 256Max Network Delay for CDP-CDP 'v' connections(msec) 512Max Network Delay for CDP-CDP 'c' connections(msec) 512Max Network Delay for CDP-CDP 't' & 'p' connections(msec) 512Max Network Delay for CDP-CDP 'a' connections(msec) 512Max Network Delay for CDP-CDP High Speed Data connections(msec) 512Max Local Delay for Interdom CDP-CDP 'v' conns (msec) 216Max Local Delay for Interdom CDP-CDP 'c' conns (msec) 216Max Local Delay for Interdom CDP-CDP 't' & 'p' conns(msec) 216Max Local Delay for Interdom CDP-CDP 'a' conns(msec) 216Max Local Delay for Interdom CDP-CDP High Speed Data conns(msec) 216Max Local Delay for Interdom High Speed Data conns (msec) 216FastPAD Jitter Buffer Size (msec) 3Enable Discard Eligibility 0Use Frame Relay Standard Parameters Bc and Be 0Enable Connection Deroute Delay feature 0Number of Consecutive Invalid Login Attempts to Cause Major Alarm 0spirit.1.8.PXM.a >dsptotals
Use the dsptotals command to view line, port, and channel totals for the current card.
Full Name
Display Totals
Card(s) on Which This Command Executes
FRSM
Syntax
dsptotals
Related Commands
None
Attributes
Log: No State: Any Privilege: 1-6Example 1-326 Show total active lines, ports, and channels on the current card
spirit.1.13.VHS2CT3.a > dsptotalstotal active lines = 0/56total active ports = 0/256total active chans = 0/1000spirit.1.13.VHS2CT3.a >dsptrafficgen
Use the dsptrafficgen command to display the status of a traffic generation test. This traffic generation test is used to determine and troubleshoot cell loss and is intended for defective PVCs.
Software Version
Command available with 1.1.20 and higher.
Full Name
Display Traffic Generation Test
Card(s) on Which This Command Executes
FRSM-VHS (2CT3/2T3/2E3/HS2)
Syntax
dsptrafficgen
Related Commands
cnftrafficgen
Attributes
Log: No State: Any Privilege: AnyExample 1-327 Display the traffic generation test on connection 16
spirit.1.1.VHS2CT3.a > dsptrafficgenPvc Under Test : 16Pattern type : 1( All 0's )Total Test Frames To Send : 100Total Test Frames Transmitted : 100Total Test Frames Received : 0dsptrapip
Use the dsptrapip command to view the IP address of the interface associated with outgoing traps. The identity of this interface is derived from your settings using the cnftrapip command.
Full Name
Display Outgoing Trap IP Address
Card(s) on Which This Command Executes
PXM
Syntax
dsptrapip
Related Commands
cnftrapip, addtrapmgr, deltrapmgr, xdsptrapmgr
Attributes
Log: No State: Active Privilege: AnyExample 1-328 Display the IP address that will be placed in outgoing traps
spirit.1.8.PXM.a > dsptrapipTrap IP Address :172.29.22.214spirit.1.8.PXM.a >dsptrapmgr
Use the dsptrapmgr command to view a list of all the SNMP Managers that are registered to receive traps. This display also presents the current aging parameter set for the traps, as defined by using the agetrapmgr command.
Full Name
Display Trap Managers
Card(s) on Which This Command Executes
PXM
Syntax
dsptrapmgr
Related Commands
agetrapmgr
Attributes
Log: No State: Any Privilege: AnyExample 1-329 Display the configuration of all the SNMP Managers that are registered to receive traps on the switch
wilco.1.7.PXM.a> dsptrapmgripAddress PortNum RowStatus ReadTrapFlag NextTrapSeqNum Aging------------ ------- ---------- ------------ -------------- ------171.71.0.54 69 Add Off 0 ENABLE171.71.54.65 162 Add Off 0 ENABLE171.71.54.69 162 Add Off 0 ENABLE172.29.37.75 2500 Add Off 100023 ENABLE172.29.37.209 2500 Add Off 100150 ENABLELastTrapSeqNum: 100150NumOfValidEntries: 5All the trap managers have aging enabled (default).wilco.1.7.PXM.a>dsptrkcnf
Use the dsptrkcnf PAR command to view the configuration for a trunk.
Full Name
Display Trunk Configuration
Card(s) on Which This Command Executes
PXM
Syntax
dsptrkcnf <slot.port>
Syntax Description
slot.port
Slot and port number.
•
•
Related Commands
addtrk, dsptrks, cnftrk, dsptrkload
Attributes
Log: No State: Any Privilege: AnyExample 1-330 Display the configuration on trunk 1 on the card in slot 7
spirit3.1.8.PXM.a > dsptrkcnf 7.1TRUNK CONFIGURATION-----------------------Statistical Reserve : 1000CC Restriction : NOLine Type :Pass Sync : TRUEDeroute Delay : 0Traffic Classes : FST FR NTS TS VOICE CBR VBR ABRRouting Cost : 10Vcc Conids : 0Vpc Conids : 0spirit3.1.8.PXM.a >dsptrkload
Use the dsptrkload PAR command to view load information for a trunk. This command applies to only the routing node implementation.
Full Name
Display Trunk Load
Card(s) on Which This Command Executes
PXM
Syntax
dsptrkload <slot.port>
Syntax Description
slot.port
Slot and port number.
•
•
Related Commands
addtrk, dsptrks, cnftrk, dsptrkcnf
Attributes
Log: No State: Any Privilege: Anydsptrks
Use the dsptrks PAR command to view all trunks on the node. This command applies to only the routing node implementation.
Full Name
Display Trunks
Card(s) on Which This Command Executes
PXM
Syntax
dsptrks
Related Commands
addtrk, cnftrk, dsptrkcnf, dsptrkload
Attributes
Log: No State: Any Privilege: Anydspunit391
Use the dspunit391 command to view the current setting for UNI T391 on a specified FRSM card.
Full Name
Display UNI T391
Card(s) on Which This Command Executes
FRSM
Syntax
dspunit391
Related Commands
addtrk, cnftrk, dsptrkcnf, dsptrkload
Attributes
Log: No State: Any Privilege: AnyExample 1-331 Display the current setting for T391
spirit.1.1.FRSM.a > dspunit391System UNI T391 = 5 secondsspirit.1.1.FRSM.a >dspupgrade
Use the dspupgrade command to view the current upgrade status of the active and the standby PXMs.
Full Name
Display Upgrade State
Card(s) on Which This Command Executes
PXM
Syntax
dspupgrade
Related Commands
rstupgrade, newrev, install, abort, commit, dspfwrevs, printrev
Attributes
Log: No State: Any Privilege: AnyExample 1-332 Display the upgrade state for the two PXMs
spirit4.1.8.PXM.a > dspupgradeactive: 'upgrade idle'standby: 'upgrade idle'spirit4.1.8.PXM.a >dspusers
Use the dspusers command to view the user IDs that have been added to the PXM configuration. The screen shows the user name and highest privilege level and displays the number of those levels above user-privilege.
Full Name
Display Users
Card(s) on Which This Command Executes
PXM
Syntax
dspusers
Related Commands
adduser, deluser
Attributes
Log: No State: Any Privilege: AnyExample 1-333 Display the users configured for this shelf. The users in this example are Raoul and Duke.
wilco.1.7.PXM.a > dspusersUserId AccessLevel-------------------------cisco CISCO_GPservice SERVICE_GPsuperuser SUPER_GPraoul GROUP3duke GROUP1wilco.1.7.PXM.a >dspver
Use the dspver command to view firmware versions currently running in both PXM cards.
Full Name
Display Firmware Version
Card(s) on Which This Command Executes
PXM
Syntax
dspver [bt]
Syntax Description
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample 1-334 Display the version of firmware running in both PXM cards
raviraj.1.7.PXM.a > dspverPXM FW versions:active: 1.1.10standby: 1.1.10dspvismip
Use the dspvismip command to view the IP configuration information for the VISM card. This command displays the results of cnfvismip configurations.
Full Name
Display VISM IP Parameters
Card(s) on Which This Command Executes
VISM
Syntax
dspvismip
Related Commands
cnfvismip
Attributes
Log: No State: Active Privilege: AnyExample 1-335 Display the IP configuration information for the current VISM card
spirit.1.5.VISM8.a > dspvismipVismIpAddress: 198.45.26.101NetMask: 255.255.255.0spirit.1.5.VISM8.a >dth
Use the dth command to view transaction trace handler statistics.
Full Name
Display Transaction Trace Handler
Card(s) on Which This Command Executes
PXM
Syntax
dth
Related Commands
cth, thtrace
Attributes
Log: No State: Active Privilege: AnyExample 1-336 Display Transaction Trace Handler Detail
spirit.1.5.VISM8.a > dthTrace Buffer is emptyspirit.1.5.VISM8.a >dvsi
Use the dvsi command to view the VIS trace buffer.
Full Name
Display VSI
Card(s) on Which This Command Executes
PXM
Syntax
dvsi
Related Commands
cvsi, vsistats, vsitrace
Attributes
Log: No State: Any Privilege: Cisco GroupExample
porky.1.7.PXM.a > dvsiVSI Trace Buffer is emptyporky.1.7.PXM.a >exit
Use the exit command to exit the current CLI shell.
Full Name
Exit from CLI
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
exit
Related Commands
bye, logout
Attributes
Log: Yes State: Any Privilege: AnyExample 1-337 Exit from the current CLI shell
spirit4.1.8.PXM.a > exit(session ended)formatdisk
Use the formatdisk command to format the disk and removes all disk contents. There is a warning prompt before this command is executed, at which point you can cancel the command. If you acknowledge the prompt, the command executes, taking about 30 minutes to format a 2 GB disk.
Full Name
Format Disk
Card(s) on Which This Command Executes
PXM
Syntax
formatdisk
Related Commands
syncdisk
Attributes
Log: No State: Any Privilege: Super Grouphelp
Use the help command to view commands associated with the current card. The help command is case-sensitive.
This command takes no arguments and therefore does not provide information about specific commands.
Full Name
Help
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
help
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
•
Example 1-338 Display current PXM card command suite
popeye3.1.8.PXM.a > helpAvailable commands------------------?abortaddapslnaddcdrscprtnaddchanaddconaddlinkaddlmiloopaddlnaddlnloopaddportaddredaddrscprtnaddserialifaddtrapmgradduseragetrapmgrarpAddarpDeleteType <CR> to continue, Q<CR> to stop:Available commands------------------arpFlusharpShowbootChangebyecccdcheckStackclidbxlevelcliPlugincliPlugoutclmiclrallcnfclralmclralmcntclratmlncntclratmlncntsclrchancntclrchancntsclrconcntType <CR> to continue, Q<CR> to stop:Available commands------------------clrconcntsclrerrclrifcntclrifcntsclrlmistatsclrlogclrportcntclrportcntsclrscrnclrsmcnfclrsrmcnfcmdhistorycnfapslncnfatmlncnfbertcnfcdprtntypecnfcdrscprtncnfchancnfchanqType <CR> to continue, Q<CR> to stop:Available commands------------------cnfclksrccnfconcnfdatecnfextclkcnfifcnfifastrkcnfifipcnfilmicnflncnfnamecnfpasswdcnfportcnfportrscprtncnfprfparamcnfrscprtncnfserialifcnfsrmclksrccnfstatsmgrcnfswfuncType <CR> to continue, Q<CR> to stop:Available commands------------------cnftimecnftmzncnftmzngmtcnftrapipcnftrkcnfupcabrcnfupccbrcnfupcubrcnfupcvbrcommitcopycpcthcvsidbxclierrcodedcctdcondbdeldelapslnType <CR> to continue, Q<CR> to stop:Available commands------------------delbertdelcdrscprtndelchandelcondeleletedelifipdellinkdellmiloopdellndellnloopdelportdelreddelrscprtndelserialifdelslotlinkdeltrapmgrdeltreedeluserdirType <CR> to continue, Q<CR> to stop:Available commands------------------dlmidnibnamednibnumdnifdnilmidownloadflashdspalmdspalmcnfdspalmcntdspalmsdspapsCfgdspapslndspatmlncnfdspatmlncntdspbertdspcddspcderrsdspcdprtntypedspcdrscprtnType <CR> to continue, Q<CR> to stop:Available commands------------------dspcdsdspchandspchancntdspchansdspclkinfodspclksrcdspcondspconcntdspconsdspcurclkdsperrdspfwdspfwrevsdspifdspifcntdspifipdspifrscdspifsdspilmiType <CR> to continue, Q<CR> to stop:Available commands------------------dspilmicntdspilmisdsplinkdsplmiloopdsplmistatsdsplndsplnrscdsplnsdsplogdsplogsdspnamedspnwipdsponoffdspparifsdspportcntdspportrscprtndspportsdspprfdspprfhistType <CR> to continue, Q<CR> to stop:Available commands------------------dspreddsprscprtndsprscprtnsdspsarchansdspsarcntdspsarcntsdspserialifdspshelfalmdspslotlinkdspsmcnfdspsrmclksrcdspstatparmsdspswfuncdsptrapipdsptrapmgrdsptrkcnfdsptrkloaddsptrksdspupgradeType <CR> to continue, Q<CR> to stop:Available commands------------------dspusersdspverdthdumpapsdumptracedvsiexitformatdiskHelphistoryifShowinstalllkAddrlkuplllmitracelogoutlsmemShowType <CR> to continue, Q<CR> to stop:Available commands------------------mkdirmkfsmodbertmvmyidnewrevonoffpagemodepasswdpingprintlogprintrevpwdremoverenameresetcdresetsysrestoreallcnfrmType <CR> to continue, Q<CR> to stop:Available commands------------------rmdirrouteAddrouteDeleterouteNetAddrouteShowroutestatShowrstupgradesaveallcnfsesntimeoutsesnwatchdogshellConnshowsyserrshutdisksmclrscrnsoftswitchstackdumpstacktraceswitchapslnType <CR> to continue, Q<CR> to stop:Available commands------------------switchbackswitchccsyncdisksyserrtaskRegsShowtaskShowthtracetimeouttmOfftmOntstcontstconsegtstdelayuncnfifastrkupifupilmiusersversionvsistatsType <CR> to continue, Q<CR> to stop:Available commands------------------vsitracevxcdvxcopyvxdvxivxllvxlsvxmvxpwdvxrebootvxrenamevxrmvxspvxsysToMonitorvxtdvxtivxtrvxtsvxttType <CR> to continue, Q<CR> to stop:Available commands------------------whowhoamixclratmlncntxclrchancntxclrifcntxcnfatmlnxcnfbertxcnfcdprtntypexcnfcdrscprtnxcnfchanxcnfifxcnfifipxcnfilmixcnfredxcnfrscprtnxcnfshelfxcnfsrmlinkxcnftrapmgrxcnfupcchanType <CR> to continue, Q<CR> to stop:Available commands------------------xcnfuserxdspatmlncnfxdspatmlncntxdspcdprtntypexdspcdrscprtnxdspcdsxdspchancntxdspchansxdspifcntxdspifsxdspilmixdspilmicntxdspportxdspredxdsprscprtnsxdspshelfxdspsrmlinkxdsptrapmgrxdspuserspopeye3.1.8.PXM.a >Display AUSM card command suitepopeye3.1.6.AUSM8.a > helpCommand Logging State Priority-------------------- ------- ------ -------------------------? No Any Any UserHelp No Any Any Useraddaimgrp Yes Active Group 1addchan Yes Active Group 2addchanloop No Active Group 4addcon Yes Active Group 2addimagrp Yes Active Group 1addln Yes Active Group 1addlnloop Yes Active Service Group (-1)addlns2aimgrp Yes Active Group 1addlns2imagrp Yes Active Group 1addport Yes Active Group 1addrscprtn Yes Active Group 1aimhelp No Any Any Userchkflash No Any Strata Group (-2)clear No Any Any Userclraimgrpcnt No Active Group 1clraimlncnt No Active Group 1clralm No Any Group 5clralmcnt No Any Group 5clralmcnts No Any Group 5clralms No Any Group 5clrcderrs No Any Super Group (0)clrchancnt No Any Group 5clrchancnts No Any Group 3clrimagrpcnt No Active Group 1clrimalncnt No Active Group 1clrimatst No Any Group 1clrmsgcnt No Any Group 5clrportcnt No Any Group 5clrportcnts No Any Group 5clrsarcnt No Any Group 5clrsarcnts No Any Group 5clrscrn No Any Any Userclrslftst No Any Any Userclrtaskinfo No Any Service Group (-1)cls No Any Any Usercnfaimgrp Yes Active Group 1cnfcdprtntype Yes Active Group 2cnfcdrscprtn Yes Active Group 1cnfchan Yes Active Group 2cnfchanfst Yes Active Group 2cnfchanq Yes Active Group 2cnfcon Yes Active Group 2cnffst Yes Active Super Group (0)cnfilmi Yes Active Group 1cnfimaalmparm No Any Group 1cnfimagrp Yes Active Group 1cnfimatst No Active Group 1cnfln Yes Active Group 1cnflnloop Yes Active Service Group (-1)cnfplpp Yes Active Group 1cnfportq Yes Active Strata Group (-2)cnfportrscprtn Yes Active Group 1cnfrscprtn Yes Active Group 1cnfslftst Yes Active Any Usercnfsvcrange Yes Active Group 1cnfupcabr Yes Active Group 2cnfupccbr Yes Active Group 2cnfupcubr Yes Active Group 2cnfupcvbr Yes Active Group 2copychans Yes Active Group 1delaimgrp Yes Active Group 1delcdrscprtn Yes Active Group 1delchan Yes Active Group 2delchanloop No Active Group 4delchans Yes Active Group 1delcon Yes Active Group 2delimagrp Yes Active Group 1delln Yes Active Group 1dellnloop Yes Active Service Group (-1)dellnsfmaimgrp Yes Active Group 1dellnsfmimagrp Yes Active Group 1delport Yes Active Group 1delrscprtn Yes Active Group 1dnport Yes Active Group 1dspaimgrp No Active Group 1dspaimgrpcnt No Active Group 1dspaimgrps No Active Group 1dspaimlncnt No Active Group 1dspalm No Any Any Userdspalmcnf No Any Any Userdspalmcnt No Any Any Userdspalms No Any Any Userdspcd No Any Any Userdspcderrs No Any Any Userdspcdprtntype Yes Active Group 2dspcdrscprtn Yes Active Group 1dspchan No Any Any Userdspchancnt No Any Any Userdspchans No Any Any Userdspcon No Any Any Userdspcons No Any Any Userdspfeature No Any Strata Group (-2)dspfst No Any Strata Group (-2)dspilmi No Any Any Userdspilmicnt No Any Any Userdspimaalmparm No Any Group 1dspimagrp No Active Group 1dspimagrpcnt No Active Group 1dspimagrps No Active Group 1dspimainfo No Active Any Userdspimaln No Any Group 1dspimalncnt No Active Group 1dspimatst No Any Group 1dsplcn No Any Any Userdspln No Any Any Userdsplns No Any Any Userdsploads No Active Any Userdspmsgcnt No Any Any Userdspplpp Yes Active Group 1dspport No Any Any Userdspportcnt No Any Any Userdspportq No Any Any Userdspportqs No Any Any Userdspportrscprtn Yes Active Group 1dspports No Any Any Userdsprscprtn Yes Active Group 1dspsarcnt No Any Any Userdspsarcnts No Any Any Userdspslftst No Any Any Userdspslftsttbl No Any Any Userdspstatparms No Any Any Userdspsvcrange Yes Any Any Userdsptaskinfo No Any Service Group (-1)dsptotals No Any Any Useri No Any Service Group (-1)memShow No Any Any Usermyid No Any Any Useroldcnfcdrscprtn Yes Active Group 1runslftstno No Any Any Usersetcmdc No Any Any Usersetpagemode No Any Any UsershellConn Yes Any Strata Group (-2)tstcon No Active Group 4tstconseg No Active Group 4tstconsti No Active Group 4tstdelay No Active Group 4tstdelaysti No Active Group 4upport Yes Active Group 1version No Any Any Userxaddcon Yes Active Group 1xclrchancnt No Any Group 3xclrportcnt No Any Group 3xcnfalm Yes Active Service Group (-1)xcnfalmcnt Yes Active Group 3xcnfcon Yes Active Group 1xcnfilmi Yes Active Group 1xcnfln Yes Active Service Group (-1)xcnfportq Yes Active Group 1xdelcon Yes Active Group 1xdnport Yes Active Group 1xdspcon No Any Any Userxdspcons No Any Any Userxdspilmi No Any Any Userxdspln No Any Any Userxdsplns No Any Any Userxdspport No Any Any Userxdspportq No Any Any Userxdspportqs No Any Any Userxdspports No Any Any Userxupport Yes Active Group 1popeye3.1.6.AUSM8.a >Example 1-339 Display FRSM card command suite
popeye3.1.3.FRSM.a > helpCommand Logging State Priority-------------------- ------- ------ -------------------------? No Any Any UserHelp No Any Any Useraddcdrscprtn Yes Active Group 1addchan Yes Active Group 2addchanloop No Active Group 4addcon Yes Active Group 2addln Yes Active Group 1addlnloop Yes Active Service Group (-1)addport Yes Active Group 1addrscprtn Yes Active Group 1chkflash No Any Strata Group (-2)clear No Any Any Userclrportcnt No Any Group 5clrportcnts No Any Group 5clrsarcnt No Any Group 5clrsarcnts No Any Group 5clrscrn No Any Any Userclrslftst No Any Any Userclrtaskinfo No Any Service Group (-1)cls No Any Any Usercnfcdprtntype Yes Active Group 1cnfcdrscprtn Yes Active Group 1cnfchancacoff Yes Active Group 2cnfchanegressq Yes Active Group 2cnfchanfst Yes Active Group 2cnfchaningressq Yes Active Group 2cnfchanmap Yes Active Group 2cnfchanpol Yes Active Group 2cnfcon Yes Active Group 2cnffst Yes Active Super Group (0)cnfln Yes Active Group 1cnflnloop Yes Active Service Group (-1)cnfoamlpbk No Any Any Usercnfport Yes Active Group 1cnfportcllm Yes Active Group 1cnfportrscprtn Yes Active Group 1cnfrscprtn Yes Active Group 1cnfslftst Yes Any Any Usercnftrafficgen No Any Any Usercnfunit391 No Active Super Group (0)copychans Yes Active Group 1copyports Yes Active Group 1delcdrscprtn Yes Active Group 1delchan Yes Active Group 2delchanloop No Active Group 4delchans Yes Active Group 1delcon Yes Active Group 2delln Yes Active Group 1dellnloop Yes Active Service Group (-1)delport Yes Active Group 1delports Yes Active Group 1downport Yes Active Group 2dspalm No Any Any Userdspalmcnf No Any Any Userdspalmcnt No Any Any Userdspalms No Any Any Userdspbufoverflow No Any Super Group (0)dspcd No Any Any Userdspcderrs No Any Any Userdspcdprtntype No Any Any Userdspcdrscprtn No Any Any Userdspchan No Any Any Userdspchancnt No Any Any Userdspchanmap No Any Any Userdspchans No Any Any Userdspchstats No Any Any Userdspcon No Any Any Userdspcons No Any Any Userdspfeature No Any Strata Group (-2)dspfst Yes Active Group 4dsplcn No Active Any Userdspln No Any Any Userdsplns No Any Any Userdspmaptbl No Any Any Userdspmsgcnt No Any Any Userdspoamlpbk No Any Any Userdspport No Any Any Userdspportcnt No Any Any Userdspportrscprtn No Any Any Userdspports No Any Any Userdspportstats No Any Any Userdsprscprtn No Any Any Userdspsarcnt No Any Any Userdspsarcnts No Any Any Userdspservrate No Any Super Group (0)dspslftst No Any Any Userdspslftsttbl No Any Any Userdspstatparms No Any Any Userdsptaskinfo No Any Service Group (-1)dsptotals No Any Any Userdsptrafficgen No Any Any Userdspunit391 No Active Any Useri No Any Service Group (-1)memShow No Any Any Usermyid No Any Any Useroldcnfcdrscprtn Yes Active Group 1queDsp No Active Any Userrunslftstno No Any Any Usersetcmdc No Any Any Usersetpagemode No Any Any UsershellConn Yes Any Strata Group (-2)tstcon No Active Group 4tstconsti No Active Group 4tstdelay No Active Group 4tstdelaysti No Active Group 4upport Yes Active Group 2version No Any Any Userxclrchancnt No Any Group 3xclrportcnt No Any Group 3xcnfalm Yes Active Service Group (-1)xcnfalmcnt Yes Active Group 3xcnfchan Yes Active Group 2xcnfln Yes Active Service Group (-1)xcnfport Yes Active Group 1xdspchan No Any Any Userxdspchancnt No Any Any Userxdspchans No Any Any Userxdspln No Any Any Userxdsplns No Any Any Userxdspport No Any Any Userxdspportcnt No Any Any Userxdspports No Any Any Userclralm No Any Group 5popeye3.1.3.FRSM.a >Example 1-340 Display VISM card command suite
spirit1.1.VISM.a > help?HelpaddchanaddconaddendptaddlnaddlnloopchkflashclralmclralmcntclralmcntsclralmsclrmsgcntclrsarcntclrsarcntsclrscrnclrtaskinfocnfalmcnfcompsizecnfcompvadcnfdomaincnfecancntcnfecanidlecnfecannoisecnfecannrcnfecannrncnfecanreccnfecantailcnfecantonecnflncnfsuipcnfvismipdelchandelcondelendptdellndellnloopdmShellConndspalmdspalmcnfdspalmcntdspalmsdspcarddspdspcddspchandspchansdspcondspconsdspdomaindspendptdspendptsdsplinedspdsplndsplnsdspmsgcntdspsarcntdspsarcntsdspsuipdsptaskinfodspvismipimemShowshellConnversionDisplay CESM card command suiteExample 1-341 Display CESM card command suite
porky.1.12.CESM.a > helpCommand Logging State Priority-------------------- ------- ------ -------------------------? No Any Any UserHelp No Any Any Useraddcdrscprtn No Any Any Useraddchan Yes Active Group 2addcon Yes Active Group 2addln Yes Active Group 1addlnloop Yes Active Service Group (-1)addport Yes Active Group 1addrscprtn No Any Strata Group (-2)chkflash No Any Strata Group (-2)clear No Any Any Userclralm No Any Group 5clralmcnt No Any Group 5clralmcnts No Any Group 5clralms No Any Group 5clrcderrs No Any Super Group (0)clrchancnt No Any Group 5clrchancnts No Any Group 3clrmsgcnt No Any Group 5clrsarcnt No Any Group 5clrsarcnts No Any Group 5clrscrn No Any Any Userclrslftst No Any Any Userclrtaskinfo No Any Service Group (-1)cls No Any Any Usercnfcdprtntype No Any Any Usercnfcdrscprtn No Any Any Usercnfchan Yes Active Group 2cnfcon Yes Active Group 2cnfln Yes Active Group 1cnfportrscprtn No Any Any Usercnfrscprtn No Any Strata Group (-2)cnfslftst Yes Active Any Usercnfswparms No Any Any Userdelcdrscprtn No Any Any Userdelchan Yes Active Group 2delchans Yes Active Group 1delcon Yes Active Group 2delln Yes Active Group 1dellnloop Yes Active Service Group (-1)delport Yes Active Group 1delports Yes Active Group 1delrscprtn No Any Strata Group (-2)dspalm No Any Any Userdspalmcnf No Any Any Userdspalmcnt No Any Any Userdspalms No Any Any Userdspcd No Any Any Userdspcderrs No Any Any Userdspcdprtntype No Any Strata Group (-2)dspcdrscprtn No Any Any Userdspchan No Any Any Userdspchancnt No Any Any Userdspchans No Any Any Userdspcon No Any Any Userdspcons No Any Any Userdspfeature No Any Strata Group (-2)dsplcn No Active Any Userdspln No Any Any Userdsplns No Any Any Userdspmsgcnt No Any Any Userdspport No Any Any Userdspportrscprtn No Any Any Userdspports No Any Any Userdspsarcnt No Any Any Userdspsarcnts No Any Any Userdspslftst No Any Any Userdspslftsttbl No Any Any Userdspstatparms No Any Any Userdsptaskinfo No Any Service Group (-1)i No Any Service Group (-1)memShow No Any Any Usermyid No Any Any Useroldcnfcdrscprtn No Any Any Useroldcnfportrscprtn No Any Any Userrunslftstno No Any Any Usersetpagemode No Any Any UsershellConn Yes Any Strata Group (-2)tstchan No Active Group 4tstchansti No Active Group 4tstcon No Active Group 4tstconsti No Active Group 4tstdelay No Active Group 4tstdelaysti No Active Group 4version No Any Any Userxclrchancnt No Any Group 3xcnfalm Yes Active Service Group (-1)xcnfalmcnt Yes Active Group 3xcnfcdprtntype No Any Strata Group (-2)xcnfcdrscprtn No Any Strata Group (-2)xcnfchan Yes Active Group 2xcnfln Yes Active Service Group (-1)xcnfport Yes Active Group 1xcnfrscprtn No Any Strata Group (-2)xdspchan No Any Any Userxdspchancnt No Any Any Userxdspchans No Any Any Userxdspln No Any Any Userxdsplns No Any Any Userxdspport No Any Any Userxdspports No Any Any Userclralm No Any Group 5clralmcnt No Any Group 5porky.1.12.CESM.a >history
Use the history command to view the last 10 commands executed on the current card.
Full Name
Display Command History
Card(s) on Which This Command Executes
PXM
Syntax
history
Related Commands
cmdhistory
Attributes
Log: No State: Any Privilege: AnyExample 1-342 Display the last 10 commands executed on the PXM card
spirit4.1.8.PXM.a > historySize of cmdHistory is currently 10 line(s)1 dspconcnt 2.39.452 dsplmistats3 dsplmiloop4 dsplm5 clrportcnt6 dspportcnts7 dspportcnt8 dspportcnt 19 dsplmistats10 historyspirit4.1.8.PXM.a >ifShow
Use the ifShow command to view the contents of all the currently configured interfaces.
Full Name
Show Interfaces
Card(s) on which This Command Executes
PXM
Syntax
ifShow
Related Commands
memShow, routeShow
Attributes
Log: No State: Any Privilege: AnyExample
spirit4.1.8.PXM.a > ifShowlnPci (unit number 0):Flags: (0x63) UP BROADCAST ARP RUNNINGInternet address: 172.29.23.149Broadcast address: 172.29.23.255Netmask 0xffff0000 Subnetmask 0xffffff00Ethernet address is 00:c0:43:00:2d:c7Metric is 0Maximum Transfer Unit size is 1500599468 packets received; 34476 packets sent0 input errors; 0 output errors0 collisionslo (unit number 0):Flags: (0x69) UP LOOPBACK ARP RUNNINGInternet address: 127.0.0.1Netmask 0xff000000 Subnetmask 0xff000000Metric is 0Maximum Transfer Unit size is 40964 packets received; 4 packets sent0 input errors; 0 output errors0 collisionssl (unit number 0):Flags: (0x71) UP POINT-TO-POINT ARP RUNNINGInternet address: 0.0.0.0Destination Internet address: 0.0.0.0Netmask 0xff000000 Subnetmask 0xff000000Metric is 0Maximum Transfer Unit size is 5760 packets received; 0 packets sent0 input errors; 0 output errors0 collisionsatm (unit number 0):Flags: (0x43) UP BROADCAST TRAILERS ARP RUNNINGInternet address: 172.1.1.149Broadcast address: 172.1.1.255Netmask 0xffff0000 Subnetmask 0xffffff00Ethernet address is 00:00:00:00:00:00Metric is 0Maximum Transfer Unit size is 15000 packets received; 47272 packets sent0 input errors; 47272 output errors0 collisionsspirit4.1.8.PXM.a >install
Use the install command after transferring a PXM firmware image (using the downloadflash command) during a system upgrade session.
Refer to to see an illustration of how the install command is used in the upgrade process.
Figure 1-6 Install Command Used in the Upgrade Process
Full Name
Install the Firmware Load
Card(s) on Which This Command Executes
PXM
Syntax
install [bt] [sm <slot>] <version>
Syntax Description
bt
Backup boot.
sm <slot>
Location of the service module card and the slot number.
version
Firmware file version.
Related Commands
dspupgrade, rstupgrade, newrev, abort, commit, dspfwrevs, printrev
Attributes
Log: No State: Active Privilege: AnyExample 1-343 Begin loading firmware 1.1.10
NODENAME.1.7.PXM.a > install 1.1.10this may take a while ...install command completed ok.please wait for the other card to enter the hold state.Example 1-344 Begin loading firmware 1.1.10, no redundancy
NODENAME.1.8.PXM.a > install 1.1.10redundancy is not availablethe other card is not availableyou are not in redundant mode,do you want to try an ungraceful upgrade(yes or no)?Example 1-345 Begin ungraceful upgrade (with redundancy)
NODENAME.1.8.PXM.a > install 1.1.11the new version is not compatible with the current version,do you want to try an ungraceful upgrade(yes or no)?Example 1-346 Begin loading firmware on backup boot
NODENAME.1.8.PXM.a > install bt 1.1.11writing pxm_bkup_masukawa.fw to flash...Board recognised as a PXM1B board ...Checksum size is 1261544 ...Erasing the flash ....FLASH erase completeDownloading C:/FW/pxm_bkup_1.1.11.fw into the flash ...verifying flash contents ....Flash ok ....Flash download completed ...copying pxm_bt_1.1.11.fw to standby...writing flash on other card...command completed ok on both pxms.The new boot code will be used after the next resetExample 1-347 Errors encountered during install command on a PXM (multiple cases)
NODENAME.1.8.PXM.a > install 1.1.10file "C:/FW/ComMat.dat" not foundA graceful upgrade cannot be performed; these two versions are notcompatible.ERR: command "install" failedNODENAME.1.8.PXM.a > install 1.1.13FW version C:/FW/pxm_1.1.13.fw is not in the appropriate directoryERR: command "install" failedNODENAME.1.8.PXM.a > install 1.1.12A graceful upgrade cannot be performed; these two versions are notcompatible.ERR: command "install" failedNODENAME.1.8.PXM.a > install bt 1.1.12writing pxm_bkup_1.1.12.fw to flash...Board recognised as a PXM1B board ...Backup boot file not found in the FW directory ...Cannot proceed ...error writing to flashERR: command "install" failedExample 1-348 Begin loading firmware on a Service Module
golden1.1.7.PXM.a > install sm 11 10.0.05Do you want to proceed (Yes/No)? yesExample 1-349 Begin loading firmware on a Service Module, no redundancy
NODENAME.1.8.PXM.a > install sm 5 10.0.05you are not in redundant mode,do you want to try an ungraceful upgrade(yes or no)?Example 1-350 Begin loading firmware for a Service Module for backup boot
NODENAME.1.8.PXM.a > install bt sm 5 FR8_BT_1.0.01downloading and burning flash on SM 5...Command completed okThe new boot code will be used after the next resetExample 1-351 Errors encountered during install command on an SM (multiple cases)
NODENAME.1.8.PXM.a > install sm 5 1.1.11Incorrect version : 1.1.11Version 1.1.11 is not availableERR: command "install" failedNODENAME.1.8.PXM.a > install bt sm 5 1.1.11Incorrect version : 1.1.11The file is not foundERR: command "install" failedlogout
Use the logout command to exit the current CLI shell.
Full Name
Log Out
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
logout
Related Commands
bye, exit
Attributes
Log: Yes State: Any Privilege: AnyExample 1-352 Log out of the current CLI shell
spirit4.1.8.PXM.a > logout(session ended)ls
Use the ls command to list the contents of the working directory. The filename is listed for each entry. The total space of the file system and free space is also summarized at the end of the output.
Full Name
List
Card(s) on Which This Command Executes
PXM
Syntax
ls
Related Commands
cd, pwd, rename, remredir, deltree, copy
Attributes
Log: No State: Any Privilege: AnyExample
raviraj.1.7.PXM.a > lsSMFWDIAGSTATSTMPCNFRPMLOGclrDBupgrade.stateconfig.sysDBfrsm_vhs_5.0.01_27May99_1_rmenon.fwfrsm_vhs_5.0.01_16Jun99_1_rmenon.fwIn the file system :total space : 819200 K bytesfree space : 700583 K bytesraviraj.1.7.PXM.a >memShow
Use the memShow command to view the current memory map.
Full Name
Show Memory
Card(s) on Which This Command Executes
PXM
Syntax
memShow
Related Commands
ifShow, routeShow
Attributes
Log: No State: Any Privilege: AnyExample 1-353 Show current memory allocation on the PXM
spirit4.1.8.PXM.a > memShowstatus bytes blocks avg block max block------ --------- -------- ---------- ----------currentfree 2967104 37 80192 2879008alloc 2561600 1774 1443 -cumulativealloc 241511616 1019558 236 -spirit4.1.8.PXM.a >mkdir
Use the mkdir command to create a new directory.
Full Name
Make directory
Card(s) on Which This Command Executes
PXM
Syntax
mkdir <path_name>
Syntax Description
Related Commands
dir, rmdir
Attributes
Log: Yes State: Any Privilege: SERVICE_GPmodbert
Use the modbert command to inject errors into the bit stream for BERT testing.
Full Name
Modify BERT
Card(s) on Which This Command Executes
PXM
Syntax
modbert <slot>
Syntax Description
Related Commands
Attributes
Log: Yes State: Active Privilege: GROUP_1moddsx3bert
Use the moddsx3bert command to inject multi-rate errors into the BERT bit stream.
Full Name
Modify DSX3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax
moddsx3bert <EIR>
Syntax Description
EIR
Value to define error insertion rate.
•
•
•
•
•
•
Related Commands
acqdsx3bert, cnfdsx3bert, deldsx3bert, dspdsx3bert, startdsx3bert, xcnfdsx3bert, xdspdsx3bert
Attributes
Log: No State: Active Privilege: Any userExample 1-354 Inject EIR 1-in-10 for the current BERT session
popeye1.1.21.CESMT3.a > moddsx3bert 2popeye1.1.21.CESMT3.a >Example 1-355 Look at results
popeye1.1.21.CESMT3.a > dspdsx3bertBert Control: Modify dsx3BertBert Resource Status State: In UseBert Owner: CLIBert Status: In SyncBert Test Medium: LineBert Port: 1Line Number : 1Bert Mode : bertPatternTestBert Pattern : doubleOneZeroLoopback type: metallicLoopbackStart time (secs.) 14:14:44Start Date FRI JUL 02 1999Bit countupper: 3Bit countlower: 389194075Bit Error Countupper 0Bit Error Countlower 14363002Error Insertion Rate: oneInTenPowerTwoError Insertion count: 0DSX3 BERT in SyncSyntax : dspdsx3bertmv
Use the mv command to rename a file or directory.
Full Name
Move
Card(s) on Which This Command Executes
PXM
Syntax
mv <path_name> <tgt_path_name>
Syntax Description
path_name
Name of the existing file or directory.
tgt_path_name
Name of the target file or directory.
Related Commands
rename
Attributes
Log: Yes State: Any Privilege: SUPER_GPmyid
Use the myid command to view information about the user of the current terminal session.
Full Name
My Identification
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
myid
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample 1-356 Display the login name of the current user—"stratacat" in this case
manish.1.7.PXM.a > myidUser ID: ciscoAccess Level: CISCO_GPTerminal Port: telnet.01manish.1.7.PXM.a >newrev
Use the newrev command to complete an upgrade/downgrade procedure on the PXM. This operation assumes that the install command has been successfully completed.
When this command executes normally, no output is returned, but the card is reset.
Refer to for an illustration of how the newrev command is used in the firmware upgrade process.
Figure 1-7 newrev Command Used in the Upgrade Process
Full Name
New revision
Card(s) on Which This Command Executes
PXM
Syntax
newrev [sm <slot>] <version>
Note
Syntax Description
slot
Slot number of the service module slot that needs to be upgraded or downgraded.
version
Firmware version.
Related Commands
rstupgrade, dspupgrade, install, abort, commit, dspfwrevs, printrev
Attributes
Log: Yes State: Active Privilege: AnyExample 1-357 Loading firmware errors (multiple cases)
NODENAME.1.8.PXM.a > newrev 1.1.11in 'upgrade idle', must be in 'upgrade install'ERR: command "newrev" failedNODENAME.1.8.PXM.a > newrev 1.1.111.1.11 is not the PXM FW seondary imageERR: command "newrev" failedExample 1-358 Loading firmware on a Service Module
golden1.1.7.PXM.a > newrev sm 11 10.0.05Do you want to proceed (Yes/No)? yesExample 1-359 Loading firmware error for a Service Module
golden1.1.7.PXM.a > newrev sm 11 10.0.05Incorrect version : 10.0.05usage: newrev [sm <slot>] <version>ERR: command "newrev" failedpagemode
Use the pagemode command to adjust the way information is presented in your console display. Set pagemode off to enable continuous scrolling of displayed information, or set pagemode on to view incremental portions of the display.
Full Name
Page mode
Card(s) on Which This Command Executes
PXM
Syntax
pagemode [off]
Syntax Description
Related Commands
None
Attributes
Log: No State: Any Privilege: Any UserExample: Set display for continuous scroll
raviraj.1.7.PXM.a > pagemode offValue of pageMode is now turned OFFraviraj.1.7.PXM.a >Example: Set display for incremental views
raviraj.1.7.PXM.a > pagemode onValue of pageMode is now turned ONraviraj.1.7.PXM.a >passwd
Use the passwd command to set the password on the PXM.
Note
Full Name
Password
Card(s) on Which This Command Executes
PXM
Syntax
password
Related Commands
cnfpasswd
Attributes
Log: Yes State: Active Privilege: Any UserExample 1-360
raviraj.1.7.PXM.a > passwdEnter password:(default password "newuser" will be used)raviraj.1.7.PXM.a >ping
Use the ping command to send an ICMP packet to a destination address to find out if the host is operational.
Full Name
Ping
Card(s) on Which This Command Executes
PXM
Syntax
ping <IP_Addr> [<Num_Packets>]
Syntax Description
IP_Addr
IP address of the destination host in dotted decimal format.
Num_Packets
Number of packets, in the range 0-65535.
•
•
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample
raviraj.1.7.PXM.a > ping 172.29.23.148PING 172.29.23.148: 56 data bytes64 bytes from 172.29.23.148: icmp_seq=0. time=0. ms64 bytes from 172.29.23.148: icmp_seq=1. time=0. ms64 bytes from 172.29.23.148: icmp_seq=2. time=0. ms----172.29.23.148 PING Statistics----3 packets transmitted, 3 packets received, 0% packet lossround-trip (ms) min/avg/max = 0/0/0raviraj.1.7.PXM.a >printrev
Use the printrev command to view the primary and secondary versions of firmware saved in the BRAM.
Full Name
Display Firmware Version
Card(s) on Which This Command Executes
PXM
Syntax
printrev
Related Commands
dspupgrade, rstupgrade, newrev, dspfwrevs, copy, install, commit, abort
Attributes
Log: No State: Any Privilege: AnyExample 1-361 Display the version of firmware running in both PXM cards
spirit4.1.8.PXM.a > printrevprimary : 1.0.00secondary : 1.0.00spirit4.1.8.PXM.a >pwd
Use the pwd command to view the current working directory on the PXM.
Full Name
Present Working Directory
Card(s) on Which This Command Executes
PXM
Syntax
pwd
Related Commands
dir, mkdir, rmdir, vxpwd
Attributes
Log: No State: Any Privilege: AnyExample
raviraj.1.7.PXM.a > pwdC:raviraj.1.7.PXM.a >remove
Use the remove command to delete a file or directory from the PXM hard drive.
Full Name
Remove
Card(s) on Which This Command Executes
PXM
Syntax
remove <path_name>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Any Privilege: SUPER_GPrename
Use the rename command to modify the current name of a file or directory.
Full Name
Rename
Card(s) on Which This Command Executes
PXM
Syntax
rename <path_name> <tgt_path_name>
Syntax Description
Related Commands
vxrename
Attributes
Log: Yes State: Any Privilege: SUPER_GPresetcd
Use the resetcd command to reset either the hardware of a selected service module or the failure history of the current card.
Using the resetcd command without defining a slot number results in an ungraceful (disruptive) upgrade. This is the fastest method to upgrade a card, but interrupts service.
A graceful (non-disruptive) upgrade requires that the install, newrev, and commit commands have already been executed, and that the card is identified in the command string.
Full Name
Reset Card
Card(s) on Which This Command Executes
PXM
Syntax
resetcd [slot number]
Syntax Description
Related Commands
install, newrev, commit
Attributes
Log: Yes State: Active Privilege: 1-3Example 1-362
porky.1.7.PXM.a > resetcd 5
resetsys
Use the resetsys command to reset the system.
Full Name
Reset System
Card(s) on Which This Command Executes
PXM
Syntax
resetsys
Related Commands
resetcd
Attributes
Log: Yes State: Active Privilege: GROUP_3Example 1-363 Reset the System
porky.1.7.PXM.a > resetsysDo you want to proceed (Yes/No)? ySyncing ......Warning: firmware reset on active PXM card by cisco@telnet.01 (172.29.52.18)(session ended)restoreallcnf
restoreallcnf
Restore All Configurations
Restores all configuration files saved to the CNF directory on the hard drive. The saved configuration is the result of a prior execution of the saveallcnf command.
To see a list of existing configurations that have been zipped by saveallcnf, cd to the C drive and list the contents of the CNF directory.
You may want to use a saved configuration file to restore the configuration on another node, or to put it somewhere safe on a workstation. In order to move it off of a hard disk and use it with the restoreallcnf command on another node, TFTP the file off of the hard disk. See the example below, where 172.29.xx.xx is the IP address. To put the file on another node, use the TFTP put instead of TFTP get, then run the restoreallcnf command.
TFTP a configuration file off of the hard disk# tftp 172.29.xx.xxtftp> bintftp> get CNF/sj885168_0226011840.zipReceived 366160 bytes in 1.7 secondstftp> quit#Card(s) on Which This Command Executes
PXM
Syntax
restoreallcnf [-f] <FILENAME> [-v]
Syntax Description
Related Commands
Attributes
rnmnd
Use the rnmnd command to renumber a routing node. This command is not applicable for a feeder node, and by default is set to 1.
Full Name
Renumber Node
Card(s) on Which This Command Executes
PXM
Syntax
rnmnd <1 | 2>
Syntax Description
Related Commands
routeDelete, routeNetAdd, routeShow, routestatShow
Attributes
Log: No State: Any Privilege: GROUP 1Example 1-364 Renumber node error on a feeder node
NODENAME.1.8.PXM.a > rnmnd 2Node renumber not allowed for Feeder NoderouteShow
Use the routeShow command to view the current IP routing of the network layer of the operating system.
Full Name
Show Routing
Card(s) on Which This Command Executes
PXM
Syntax
routeShow
Related Commands
routestatShow
Attributes
Log: No State: Any Privilege: AnyExample 1-365 Display the current IP routing of the network layer of the operating system
spirit4.1.8.PXM.a > routeShowROUTE NET TABLEdestination gateway flags Refcnt Use Interface------------------------------------------------------------------------0.0.0.0 172.29.23.149 1 1 21778 lnPci00.0.0.0 172.29.23.1 3 0 2755 lnPci0172.1.1.0 172.1.1.149 1 0 0 atm0172.29.23.0 172.29.23.149 1 2 5275 lnPci0------------------------------------------------------------------------ROUTE HOST TABLEdestination gateway flags Refcnt Use Interface------------------------------------------------------------------------0.0.0.0 0.0.0.0 5 0 0 sl0127.0.0.1 127.0.0.1 5 1 0 lo0172.29.23.3 172.1.1.149 5 0 3555 atm0172.29.23.5 172.1.1.149 5 0 3304 atm0172.29.23.7 172.1.1.149 5 0 3335 atm0171.71.29.18 172.1.1.149 5 0 3304 atm0172.29.23.18 172.1.1.149 5 0 3304 atm0172.29.23.28 172.1.1.149 5 0 6127 atm0172.29.23.29 172.1.1.149 5 1 6065 atm0171.71.29.32 172.1.1.149 5 0 5842 atm0171.71.29.44 172.1.1.149 5 0 3304 atm0172.29.23.53 172.1.1.149 5 0 3304 atm0171.71.29.59 172.1.1.149 5 0 3304 atm0171.71.28.126 172.1.1.149 5 0 3309 atm0------------------------------------------------------------------------spirit4.1.8.PXM.a >routestatShow
Use the routestatShow command to view the current IP routing statistics for the network layer of the operating system.
Full Name
Show Routing Statistics
Card(s) on Which This Command Executes
PXM
Syntax
routestatShow
Related Commands
routeShow
Attributes
Log: No State: Any Privilege: AnyExample 1-366 Display the current IP routing statistics for the network layer of the operating system
spirit4.1.8.PXM.a > routestatShowrouting:0 bad routing redirect0 dynamically created route0 new gateway due to redirects0 destination found unreachable11095 uses of a wildcard routespirit4.1.8.PXM.a >rstupgrade
Use the rstupgrade command to cancel the software upgrade process. In normal circumstances, the abort command is the best way to stop the software upgrade process. However, if a hardware failure or other error occurs during the installation, run the rstupgrade command to cancel the installation. Run the dspupgrade command to display the status. The status "upgrade idle" indicates that the upgrade has been cancelled. You then can correct the cause of the error, and start the upgrade process again.
Refer to Figure 1-8 for an illustration of how the rstupgrade command is used in the upgrade process.
Figure 1-8 rstupgrade Command Used in the Upgrade Process
Full Name
Reset Upgrade
Card(s) on Which This Command Executes
PXM
Syntax
rstupgrade
Related Commands
dspupgrade, newrev, install, abort, commit, dspfwrevs, printrev
Attributes
Log: No State: Active Privilege: AnyExample 1-367 Reset upgrade and display upgrade
spirit4.1.8.PXM.a >rstupgradespirit4.1.8.PXM.a > dspupgradeactive: 'upgrade idle'standby: 'upgrade idle'spirit4.1.8.PXM.a >runslftstno
Use the runslftstno command activate the self-test for the specified self-test number on the current card.
Full Name
Run Self-Test Number
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
runslftstno <Test #>
Syntax Description
Test #
Number of the test to run during this session. If this parameter is omitted, all
tests are run.
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1-2
Examples
This section contains the following examples.
•
•
•
Example 1-368 Run all self-tests on the current AUSM card
spirit.1.19.AUSM8.a > runslftstnoTest # Test Name Thold Fail Pass Last Enab Destr Card Rst1 DRAM access test 1 0 0 P Y N Y2 SRAM access test 1 0 0 P Y N Y3 GRAM access test 1 0 0 P Y N Y4 BRAM checksum test 1 0 0 P Y Y Y5 CODE checksum test 1 0 0 P Y N Y6 Line loopback test 1 0 0 P Y Y Y7 CellBus test 1 0 0 P Y N N8 DPRAM test 1 0 0 P Y N Y9 CSERAM test 1 0 0 P Y N Y10 CAM test 1 0 0 P Y Y Y11 IMA grp lpbk test 1 0 0 P Y Y Yrunslftstno "Test #"spirit.1.19.AUSM8.a >Example 1-369 Run all self-tests on the current FRSM card
spirit.1.1.FRSM.a > runslftstnoTest # Test Name Thold Fail Pass Last Enab Destr Card Rst1 DRAM access test 1 0 0 P Y N Y2 SRAM access test 1 0 0 P Y N Y3 GRAM access test 1 0 0 P Y N Y4 BRAM checksum test 1 0 0 P Y N Y5 CODE checksum test 1 0 0 P Y N Y6 Line loopback test 1 0 0 P Y Y Y7 M32 test 1 0 0 P Y Y N8 Data loopback test 1 0 0 P N Y Y9 CellBus test 1 0 0 P Y N Nrunslftstno "Test #"spirit.1.1.FRSM.a >Example 1-370 Run all self tests on the current FRSM-2CT3 card
spirit.1.3.VHS2CT3.a > runslftstnoTest # Test Name Thold Fail Pass Last Enab Destr Card Rst1 CPU DRAM access test 1 0 0 P Y N Y2 SAR self test 1 0 0 P Y N Y3 ISE self test 1 0 0 P Y N Y4 ESE self test 1 0 0 P Y N Y5 CODE checksum test 1 0 0 P Y N Y6 Line loopback test 1 0 0 P Y Y Y7 FREEDM test 1 0 0 P Y Y Y8 Data loopback test 1 0 0 P Y Y Y9 CellBus test 1 0 0 P Y N Nrunslftstno "Test #"spirit.1.3.VHS2CT3.a >Example 1-371 Run the self test with the specified self test number on the current card
spirit.1.3.VHS2CT3.a > runslftstno 1Test Number 1 Result: PASSspirit.1.3.VHS2CT3.a >saveallcnf
Save All Configuration
Save All Configurations—save all configuration files to a zip file on the hard drive.
Warning
The saveallcnf command saves all configurations to a zipped file in the CNF directory on the hard drive. The zip file can then be used to restore the configuration at a later time. This command takes significant time to execute, so a warning message prompts you for confirmation before the system performs the task. Upon completion, the system displays the name of the saved configuration file, in the form nodename.zip. Be sure to use the -v parameter with this command in releases prior to 1.1.34 in order to display the file name.
The system stores up to three zipped configuration files. If you want to save more than two configurations, use FTP to transfer the files to another device.
After you execute the saveallcnf command, you may want to use the saved configuration file to restore the configuration on another node, or to put it somewhere safe on a workstation. In order to do this, you can TFTP the file off of the hard disk. See the example below, where 172.29.xx.xx is the IP address.
Example 1-372 TFTP a configuration file off of the hard disk
# tftp 172.29.xx.xxtftp> bintftp> get CNF/sj885168_0226011840.zipReceived 366160 bytes in 1.7 secondstftp> quit#To restore the system configuration, use the restoreallcnf command. To abort a configuration save, use abortallsaves command.
Card(s) on Which This Command Executes
PXM
Syntax
saveallcnf -v
Syntax Description
Related Commands
Attributes
sesntimeout
Use the sesntimeout command to define maximum idle time, in seconds, for the current session. If you do not specify a timeout period in seconds, the system displays the current timeout. To disable the session timeout function, enter a 0.
Full Name
Session Timeout
Card(s) on Which This Command Executes
PXM
Syntax
sesntimeout [time_out]
Syntax Description
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
Example 1-373 Display the current timeout
spirit.1.7.PXM.a > sesntimeoutThe timeout period for this session is currently 600 second(s)spirit.1.7.PXM.a >Example 1-374 Set the session timeout threshold to 12 minutes (720 seconds)
spirit.1.7.PXM.a > sesntimeout 720The timeout period for this session is now set to 720 second(s)spirit.1.7.PXM.a >shutdisk
Use the shutdisk command to quiesce the disk.
Note
Note
Full Name
Shut Down the Disk
Card(s) on Which This Command Executes
PXM
Syntax
shutdisk
Related Commands
syncdisk, formatdisk
Attributes
Log: No State: Any Privilege: SUPER_GPsoftswitch
Use the softswitch command to transfer control from the active primary service module to the active secondary (or redundant) service module. The primary service module will reboot and come up in standby mode. Use the switchback command to revert to normal operation after a softswitch.
Full Name
Switch to Redundant from Primary
Card(s) on Which This Command Executes
PXM
Syntax
softswitch <PrimarySlotNum> <SecondarySlotNum>
Syntax Description
PrimarySlotNum
Slot number of the primary card, in the range 1-6, or 9-14, or 17-22,
or 25-30.SecondarySlotNum
Slot number of the secondary card, in the range 1-6, or 9-14, or 17-22,
or 25-30.
Related Commands
switchback, addred, delred, dspred
Attributes
Log: No State: Active Privilege: Any
startdsx3bert
Use the startdsx3bert command to start a BERT testing session. You must reset the BERT counters, using the clrbertcntrs command, prior to using the startdsx3bert command.
Full Name
Start DSX3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax
startdsx3bert
Related Commands
acqdsx3bert, clrbertcntrs, cnfdsx3bert, dspdsx3bert
Attributes
Log: No State: Active Privilege: AnyExample 1-375 Start a bert testing session on the selected service module
popeye1.1.21.CESMT3.a > startdsx3bertpopeye1.1.21.CESMT3.a >switchapsln
Use the switchapsln command to control APS switching actions. This function applies to OC-3 and
OC-12 lines.Full Name
Switch APS Line
Card(s) on Which This Command Executes
PXM
Syntax
switchapsln <line number> <operation>
Syntax Description
Related Commands
addapsln, cnfapsln, delapsln, dspapsln
Attributes
Log: Yes State: Active Privilege: 1switchback
Use the switchback command to revert to normal operation after a softswitch. The switchback command transfers control from the active secondary (or redundant) service module back to the active primary service module. The secondary (or redundant) service module will reboot and will come up in standby mode
Full Name
Switch Back to Primary from Redundant
Card(s) on Which This Command Executes
PXM
Syntax
switchback <PrimarySlotNum> <SecondarySlotNum>
Syntax Description
PrimarySlotNum
Slot number of the primary card, in the range 1-6, or 9-14, or 17-22, or 25-30.
SecondarySlotNum
Slot number of the secondary card, in the range 1-6, or 9-14, or 17-22, or 25-30.
Related Commands
softswitch, addred, delred, dspred
Attributes
Log: No State: Active Privilege: Any
switchcc
Use the switchcc command to transfer control of the MGX 8800 series shelf from the active PXM to the standby PXM. If a standby PXM is not available, the command is not executed.
During a config copy, this command is disabled. If the command is attempted during a config copy, a "Can't execute, BRAM or FLASH is being updated" message is displayed.
Full Name
Switch Core Cards
Card(s) on Which This Command Executes
PXM
Syntax
switchcc
Related Commands
None
Attributes
Log: Yes State: Active Privilege: 1-3Example 1-376 Attempt to switchcc without a standby PXM on the shelf
raviraj.1.7.PXM.a > switchccDo you want to proceed (Yes/No)? yCore card redundancy unavailableraviraj.1.7.PXM.a >syncdisk
Use the syncdisk command to flush out the write buffers to the disk and put the device in standby mode. Use the syncdisk command before you remove the PXM card or reset the shelf.
Full Name
Synchronize Disk
Card(s) on Which This Command Executes
PXM
Syntax
syncdisk
Related Commands
formatdisk
Attributes
Log: No State: Any Privilege: Anytimeout
Use the timeout command to set maximum idle time, in seconds, for the current session on the PXM. If you do not specify a timeout period in seconds, the system displays the current timeout. To disable the session timeout function, enter a 0.
Full Name
Session Timeout
Card(s) on Which This Command Executes
PXM
Syntax
timeout [time_out]
Syntax Description
Related Commands
sasntimeout
Attributes
Log: No State: Any Privilege: SuperUserExamples
This section contains the following examples:
•
•
Example 1-377 Display the current timeout
spirit.1.7.PXM.a > timeoutThe timeout period for this session is currently 600 second(s)spirit.1.7.PXM.a >Example 1-378 Set the session timeout threshold to 12 minutes (720 seconds)
spirit.1.7.PXM.a > timeout 720The timeout period for this session is now set to 720 second(s)spirit.1.7.PXM.a >tstcon
Use the tstcon command to tests the integrity of a connection between an MGX 8800 series card and a remote end within the WAN switching network by sending a single collection of supervisory cells to the remote end. The terminal displays only a pass or fail message.
Full Name
Test Connection
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: Service Modules
tstcon <channel number>
Syntax Description
Syntax: PXM
tstcon <con_id>
Syntax Description
con_id
Connection identifier, in the format port.vpi.vci.
•
•
•
Related Commands
dspcons, tstconseg, tstdelay
Attributes
Log: No State: Any Privilege: 1-4Syntax: AUSM
tstcon <port.VPI.VCI | channel number>
Syntax Description
Related Commands
dspcons, tstconseg, tstdelay
Attributes
Log: No State: Any Privilege: 1-4Example 1-379 Testing a connection on the current AUSM (using the port.VPI.VCI argument)
s1.1.12.AUSM8.a > tstcon 2.1.1Example 1-380 Testing a connection on the current AUSM (using the channel number argument)
s1.1.12.AUSM8.a > tstcon 21Output:tstcon in progressTest passed.tstconseg
Use the tstconseg command to test the integrity of a connection between an MGX 8800 series card and service equipment (CPE) by sending a single collection of supervisory cells to the remote end. The terminal displays only a pass or fail message.
Full Name
Test Connection Segment
Card(s) on Which This Command Executes
PXM, AUSM-8T1E1
Syntax for PXM
tstconseg <channel number>
Syntax Description
Syntax for AUSM-8T1E1
tstconseg <port.VPI.VCI | channel number>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation
VPI range = 1-4095
VCI range = 1-65535
chan_num
Channel number, in the range 16-1015
Related Commands
dspcons, tstcon, tstdelay
Attributes
Log: No State: Any Privilege: 1-4Example 1-381 Testing the connection between the current AUSM card and the service equipment (CPE) using the port.VPI.VCI argument
s1.1.12.AUSM8.a > tstconseg 2.1.1Output:tstcon in progressTest passed.Example 1-382 Testing the connection between the current AUSM card and the service equipment (CPE) using the channel number argument
s1.1.12.AUSM8.a > tstconseg 21Output:tstcon in progressTest passed.tstdelay
Use the tstdelay command to conduct an external connectivity test by sending a single collection of supervisory cells to the remote end to the network and back. The terminal displays a pass or fail message and the round-trip time in milliseconds.
Full Name
Test Round Trip Delay
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: FRSM, CESM
tstdelay <channel number>
Syntax Description
Syntax: PXM
tstdelay <con_id>
Syntax Description
con_id
Connection identifier, in the format port.vpi.vci.
•
•
•
Syntax: AUSM-8T1E1
tstdelay < port.VPI.VCI | channel number>
Syntax Description
port.VPI.VCI
Port range = 1-n, as appropriate for the physical installation.
VPI range = 1-4095.
VCI range = 1-65535.
channel number
Channel number, in the range 16-1015.
Related Commands
dspcons, tstcon
Attributes
Log: No State: Active Privilege: 1-4Example 1-383 Test the delay for a round trip to and from the network on channel 16
MGX 880061.1.10.AUSM.a > tstdelay 16TestDelay in progress.TestDelay Passed with 2 ms.Example 1-384 Test the delay for a round trip to and from the network from the current AUSM card on port 2, VPI 1, VCI 1
s1.1.12.AUSM8.a > tstdelay 2.1.1Output:tstdelay in progressDelay Test Passed with 2 ms.Example 1-385 Test the delay for a round trip to and from the network from the current AUSM card on channel 21
s1.1.12.AUSM8.a > tstdelay 21Output:tstdelay in progressDelay Test Passed with 1 ms.uncnfifastrk
Use the PAR uncnfifastrk command to restore trunk routing operations on a PXM line.
Note
Full Name
Unconfigure Interface as Trunk
Card(s) on Which This Command Executes
PXM
Syntax
uncnfifastrk <slot.port> <iftype>
Syntax Description
Related Commands
cnfifastrk
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-386 Return the line on port 1 in slot 7 to use as a routing trunk
MGX-01.1.7.PXM.a > uncnfifastrk 7.1 rtrkMGX-01.1.7.PXM.a >An error message occurs if trunks are not deleted prior to invoking the uncnfifastrk command.
upif
Use the upif command to add a logical interface to a broadband port on a PXM. The purpose of configuring logical interfaces for a line is to create a structure for resource partitioning. The network control applications (PAR, Tag, and so on) require resources linked to the logical interfaces.
A PXM can have 1-32 logical interfaces regardless of the number of physical lines. With multiple lines serving as uplinks, you can divide the 32 logical interfaces between the active lines according to need, yet each line would still have the full range of VPIs and VCIs. In summary, the number of logical interfaces per line can vary, but the maximum number of VPIs and VCIs is fixed (with the actual range subject to your configuration). To change the configuration of an existing logical interface on the PXM, use the cnfif command.
Note
Full Name
Up Interface
Card(s) on Which This Command Executes
PXM
Syntax
upif <if_num> <line_num> <pct_bw> <min_vpi> <max_vpi>
Syntax Description
Related Commands
upif
Attributes
Log: No State: Active Privilege: 1-4Example 1-387 The first "1" is the logical interface number; the second "1" is the line number on the PXM back card to which you are assigning this logical interface number; "100" is the percentage of bandwidth available to this logical interface in both directions; and the VPI range is 1-2000
spirit.1.7.PXM.a > upif 1 1 100 1 2000spirit.1.7.PXM.a >upport
Use the upport command to activate a specified AUSM port.
Full Name
Up port
Card(s) on Which This Command Executes
AUSM
Syntax
upport <PortNum>
Syntax Description
Related Commands
dnport
Attributes
Log: Yes State: Active Privilege: 1users
Use the users command to view details associated with currently active users on the PXM. The screen display shows the means through which each user logged into the switch, the slot number of the current card, and the login name of the users.
Full Name
Display the names of all users currently logged in to the switch
Card(s) on Which This Command Executes
PXM
Syntax
users
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExample 1-388 Display the users logged into the switch
spirit.1.7.PXM.a > usersPort Slot Idle UserId From-------------------------------------------------------------telnet.01 * 7 0:00:00 cisco 171.71.25.240telnet.02 3 0:07:03 cisco 171.71.25.240spirit.1.7.PXM.a >version
Use the version command to view different types of version-related information, such as firmware version, operating system kernel version, the date of the software build, and so on (refer to screen examples).
Full Name
Display Versions
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM, VISM
Syntax
version
Related Commands
None
Attributes
Log: No State: Any Privilege: AnyExamples
This section contains the following examples:
•
•
•
•
Example 1-389 Display version information on the current PXM card
spirit.1.7.PXM.a > versionVxWorks (for MGX 8850) version 5.3.1.Kernel: WIND version 2.5.Made on Feb 13 1999, 07:40:57.Boot line:lnPci(0,0) e=172.29.37.40 g=172.29.37.1PXM firmware version : 1.0.00cp1Boot Image Version : 1.0.00avspirit.1.7.PXM.a >Example 1-390 Display version information on the current FRSM card
MGX 88003.1.11.FRSM.a > version***** Cisco Systems, Inc. MGX 8800 FRSM Card *****Firmware Version = eqa2.0.1gBackup Boot version = model-B BT_2.0.0PXMFRSM Xilinx file = frsm025.hVxWorks (for STRATACOM) version 5.1.1-R3000.Kernel: WIND version 2.4.Made on Wed Jan 13 19:45:10 PST 1999.Boot line:MGX 88003.1.11.FRSM.a >Example 1-391 Display version information on the current VISM card
spirit.1.5.VISM8.a > version***** Cisco Systems. AXIS VISM Card *****Firmware Version = rangarBackup Boot version = 3.2.02Xilinx Firmware version = 10/ 2/1998DSPCOM FPGA version = 1/20/1999DSPM Firmware Details:Major Release = 3Minor Release = 0Build number = 12DSPM ecan Firmware Details:Major Release = 7Minor Release = 3Build number = 9e1VxWorks (for R5k PDC) version 5.3.1.Kernel: WIND version 2.5.Made on Mar 9 1999, 14:19:21.Boot line:spirit.1.5.VISM8.a >Example 1-392 Display version information on the current AUSM card
MGX 88003.1.14.AUSM.a > version***** Cisco Systems, Inc. MGX 8800 AUSM Card *****Firmware Version = model-A 2.0.00Backup Boot version = model-A BT_eqa2.0.1AUSM Xilinx file = ausmfract.hVxWorks (for STRATACOM) version 5.1.1-R3000.Kernel: WIND version 2.4.Made on Thu Jan 21 17:57:59 GMT 1999.Boot line:MGX 88003.1.14.AUSM.a >who
Use the who command to view details associated with user IDs currently active on the PXM.
Full Name
Who
Card(s) on Which This Command Executes
PXM
Syntax
who
Related Commands
adduser, deluser, whoami
Attributes
Log: No State: Any Privilege: AnyExample 1-393 Display the users logged into the current card
spirit.1.7.PXM.a > whoPort Slot Idle UserId From-------------------------------------------------------------telnet.01 * 7 0:00:00 cisco 171.71.25.240spirit.1.7.PXM.a >whoami
Use the whoami command to view the current login ID, access level, and associated terminal port.
Full Name
Who Am I
Card(s) on Which This Command Executes
PXM
Syntax
whoami
Related Commands
adduser, deluser, who
Attributes
Log: No State: Any Privilege: AnyExample 1-394 Display information about the user of the current terminal session
spirit.1.7.PXM.a > whoamiUser ID: ciscoAccess Level: CISCO_GPTerminal Port: telnet.01spirit.1.7.PXM.a >xaddcon
Use the xaddcon command to adds a connection to the current AUSM. No messages appear on screen after command entry unless the command cannot execute as entered.
Full Name
Add Connection
Card(s) on Which This Command Executes
AUSM
Syntax
xaddcon <channel number> <connection type> <port number> <vpi> <vci> <service type>
<egress queue number>Syntax Description
Related Commands
delcon, dspcons, dspcon
Attributes
Log: Yes State: Active Privilege: 1-2Example 1-395 Add a VCC connection to channel 16 on port 1 with vpi=1, vci=1, ABR service type, and an egress queue number of 1
MGX 88003.1.14.AUSM.a > xaddcon 16 2 1 1 1 3 1MGX 88003.1.14.AUSM.a >A system response does not occur unless an error is detected.
xclrchancnt
Use the xclrchancnt command to clear the channel counters for a specified Frame Relay channel on a specified card. Counting resumes after the command executes.
Full Name
Clear Channel Counters
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax: PXM
xclrchancnt -cnt <chanNum> -cc <clrButton>
Syntax Description
Syntax: FRSM, AUSM, CESM
xclrchancnt -chn <channel number>
Syntax Description
Related Commands
dspchan, clrchancnts, dspchancnt
Attribute
Log: No State: Any Privilege: 1-5
xclrportcnt
Use the xclrportcnt command to clear port counter values from the current AUSM or FRSM.
No message appears upon successful execution of the command.
Full Name
Clear Port Counters
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
xclrportcnt -pt <port number>
Syntax Description
Related Commands
clrportcnts, xdspportcnt, xdspportcnt, dspportcnt
Attributes
Log: No State: Any Privilege: 1-5
xcnfalm
Use the xcnfalm command to configures extended alarm counters and statistics for the specified line.
Full Name
Configure Extended Alarm Counters and Statistics
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
xcnfalm -ds1 <LineNum> -red <RedSeverity> -rai <RAISeverity> -neu <NEAlarmUpcount> -ned <NEAlarmDncount> -net <NEAlarmThreshold> -feu <FEAlarmUpcount> -fed <FEAlarmDncount> -fet <FEAlarmThreshold>
Syntax Description
Related Commands
xcnfalmcnt
Attributes
Log: Yes State: Active Privilege: 1Example 1-396 To configure the ds1 line 1 alarms so that RED and RAI are both minor alarms, and the up and down counts and threshold for both FE and NE are all set to 100
MGX 88003.1.14.AUSM.a > xcnfalm -ds1 1 -red 1 -rai 1 -neu 100 -ned 100 -net 100 -feu 100 -fed 100 -fet 100MGX 88003.1.14.AUSM.a >xcnfalmcnt
Use the xcnfalmcnt command to configure the extended alarm counters for the specified line.
Full Name
Configure Alarm Counters
Card(s) on Which This Command Executes
AUSM, FRSM, CESM
Syntax
xcnfalmcnt -ds1 <LineNum> -sev <StatisticalAlarmSeverity> -lcv15 <lCV15minThreshold> -lcv24 <lCV24hrThreshold> -les15 <lES15minThreshold> -les24 <lES24hrThreshold> -lses15 <lSES15minThreshold> -lses24 <lSES24hrThreshold> -crc15 <cRC15MinThreshold> -crc24 <cRC24HrThreshold> -crces15 <cRCES15MinThreshold> -crces24 <cRCES24HrThreshold> -crcses15 <cRCSES15MinThreshold> -crcses24 <cRCSES24hrThreshold> -sefs15 <sEFS15minThreshold> -sefs24 <sEFS24hrThreshold> -aiss15 <aISS15minThreshold> -aiss24 <aISS24hrThreshold> -uas15 <uAS15minThreshold> -uas24 <uAS24hrThreshold>
Syntax Description
Related Commands
cnfalm, dspalmcnt
Attributes
Log: Yes State: Active Privilege: 3xcnfbert
Use the xcnfbert command to set up a Bit Error Rate Test (BERT) and to add or remove loops on the ports and lines of a specified SM.
A BERT test session does not time out automatically. Use the delbert command to conclude the test.
Note
Full Name
Configure Bit Error Rate Test
Card(s) on Which This Command Executes
PXM
Syntax
xcnfbert -bcntl <bertControl> -bsl <bertSlotNum> -bmed <bertTestMedium> -bpt <bertPort> -bline <bertLine> -bmode <bertMode> -bdtl <bertDeviceToLoop> -bcnt <bertDS0DPIterationCount> -bpat <bertPattern> -blpbk <bertLoopback> -blpbkop <bertLoopbackOperation> -buid <bertUserId>
Syntax Description
Related Commands
delbert
Attributes
Log: Yes State: Active Privilege: SUPER_GPxcnfdsx3bert
Use the xcnfdsx3bert command to specify a pattern for BERT testing on the FRSM.
Full Name
Configure DS3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3
Syntax
xcnfdsx3bert -dsx3bct <state> -dsx3btm <medium> -dsx3bln <line num> -dsx3bmo <mode> -ds3bei <EIR> -ds3bpt <test pattern>
Syntax Description
Related Commands
xdspdsx3bert
Attributes
Log: No State: Active Privilege: Anyxcnfif
Use the xcnfif command to modify parameters for an existing broadband interface on a PXM. System software does not allow you to conflict with existing configurations. You may need to reduce the bandwidth allocation or VPI/VCI range on one or more interfaces before you expand the resources for a interface. Refer to the upif command description for more information on resource partitioning.
Full Name
Configure a Broadband Interface
Card(s) on Which This Command Executes
PXM
Syntax
xcnfif -if <bbIfNum> -bl <lineNum> -ie <rowStatus> -ib <ingrPctBw> -eb <egrPctBw> -iv <minVpi> -av <maxVpi>
Syntax Description
Related Commands
upif
Attributes
Log: No: Yes State: Any Privilege: CISCO_GPExamples
This section contains the following examples.
•
•
Example 1-397 Configure and enable broadband interface number 1 on line 4 to use 10% of the line bandwidth for both ingress and egress, have a minimum virtual path interface (VPI) of 0, and a maximum virtual path interface (VPI) of 19
wilco.1.7.PXM.a > xcnfif -if 1 -bl 4 -ie 1 -ib 10 -eb 10 -iv 0 -av 19wilco.1.7.PXM.a >A system response does not occur unless an error is detected. To verify your entries, use the dspifip command.
Example 1-398 Verify broadband configuration on the PXM
wilco.1.7.PXM.a > dspif
ifNum Status Line ingrPctBw egrPctBw minVpi maxVpi------------------------------------------------------1 Ena 1 10 10 0 19wilco.1.7.PXM.a >xcnfifip
Use the xcnfifip command to set the IP address for the LAN, Slip, and ATM interfaces.
Full Name
Configure Interface for IP
Card(s) on Which This Command Executes
PXM
Syntax:
xcnfifip -ifn <Interface> -ipa <ip_addr> -msk <NetMask> -bc <Brocast addr> -ipo <Oper>
Syntax Description
Attributes
Log: Yes State: Any Privilege: SUPER_GPExamples
This section contains the following examples:
•
•
Example 1-399 Configure and enable the Ethernet interface to use the IP address 172.29.37.40, the netmask 255.255.255.000, and the broadcast address 255.255.255.000
spirit4.1.7.PXM.a > xcnfifip -if 26 -ipa 172.29.37.40 -msk 255.255.255.000 -bc 255.255.255.000 -ipo 1spirit4.1.7.PXM.a >A system response does not occur unless an error is detected. To verify your entries, use the dspifip command.
Example 1-400 Verify the IP Address configuration
spirit4.1.7.PXM.a > dspifip
Interface IPAddress NetMask BroadcastAddress------------ ----------------- ----------------- -----------------Ethernet 172.29.37.40 255.255.255.000 255.255.255.000Slip 192.169.3.18 255.255.255.000ATM 255.255.255.000spirit4.1.7.PXM.a >xcnfilmi
Use the xcnfilmi command to configure local management interface for a port. No messages appear on screen unless an error occurs.
Full Name
Configure ILMI
Card(s) on Which This Command Executes
AUSM
Syntax
xcnfilmi -pti <port_num> -s <signal_type> -vpi <virtual_path_identifier> -vci <virtual_channel_identifier> -t <trap_enable> -mti <min_trap_int> -kap <keep_alive> -eth <ErrorThreshold> -evh <EventThreshold> -pi <PollingInterval> -mei <MinimumEnquiryInterval> -ar <AddrRegEnable>
Syntax Description
Related Commands
xdspilmi, dspilmi, dspilmicnt
Attributes
Log: Yes State: Active Privilege: 1xcnfln
Use the xcnfln command to configure a line on the current card to be either T1 or E1. If the command line does not include the E1 signalling parameter, the line is a T1.
For an FRSM-HS1 card, the xcnfln command is used to configure either an X.21 or a V.35 line.
Full Name
Configure Line
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
xcnfln <line_num> <line_code> <line_len> <clk_src> [E1-signaling]
Syntax Description
Syntax for FRSM-HS1
xcnfln xcnfln -hs1 <LineNum> -e <Enable> -lt <LineType> -sp <LineRate> -lpb <LoopCmd>
-sc <SendCode> -detect <LoopbackCodeDetection> -clktype <InvertClock>Syntax Description
Related Commands
cnfln, addln, delln
Attributes
Log: Yes State: Active Privilege: 1Example 1-401 Configure line 4 to be T1 with B8ZS line coding, have a length of 1, and use the loop clock as a clock source
MGX 88003.1.11.FRSM.a > xcnfln 4 2 1 1MGX 88003.1.11.FRSM.a >Example 1-402 Configure line 1 for remote loopback and send codes for remote loop on the current FRSM card
man.1.4.FRSM.a > xcnfln -hs1 1 -e 3 -lpb 4 -sc 5xcnfport
Use the xcnfport command to configure a service port on an FRSM or an AUSM.
The screen does not display a message after successful command entry. The configuration can be verified using the xdspport or dspport command.
The syntax for this command differs according to the service module being addressed.
Card(s) on Which This Command Executes
FRSM, AUSM
Full Name
Configure Port
Syntax: FRSM
xcnfport <port_num> <PortLineNum> <PortEnable> <lmi_sig> <asyn> <T391> <T392> <N391> <N392> <N393> <CLLMEN> <CLLMTM>
Syntax Description
Possible errors are
•
•
•
Related Commands
xcnfport, addport, delport, dspport, dspports, xdspport, xdspports
Attributes
Log: Yes State: Active Privilege: 1-6Syntax: AUSM
xcnfport <port_num> <plpp loopback>
Syntax Description
port_num
Port number, in the range 1-8.
plpp loopback
Value to set type of Physical Layer Protocol Processor loopback.
•
•
•
Related Commands
cnfport, addport, delport, dspport, dspports, xdspport, xdspports
Attributes
Log: Yes State: Active Privilege: 1System Response
A system response does not occur unless an error is detected.
xcnfportq
Use the xcnfportq command to configure queue parameters on a port associated with the current AUSM.
A system response does not occur unless an error is detected.Full Name
Configure Port Queue
Card(s) on Which This Command Executes
AUSM
Syntax
xcnfportq -pt <ServicePortNum> -pqn <PortQNumber> -e <Enable> -sn <SequenceNo> -qdm <QueueDepthMax> -clph <EgressQCLPThreshHigh> -clpl <EgressQCLPThresLow> -clpt <EgressQEFCIThresh> -qa <EgressQAlgorith> -mxbi <EgressMaxBandwidthInc> -mibi <MinimumBandwidthInc>
Syntax Description
Related Commands
cnfportq, xcnfportqs
Attributes
Log: Yes State: Active Privilege: 1-6Example 1-403
spirit3.1.22.AUSM8.a > xcnfportq -pt 1spirit3.1.22.AUSM8.a >xcnfred
Use the xcnfred command to set redundancy between two PXM slots, and to set the primary and secondary PXMs in the pair. Redundancy can be 1:1 or 1:n. If the redundancy is 1:n, repeat the xcnfred command for each secondary slot to be linked to the primary slot.
Full Name
Configure Redundancy
Card(s) on Which This Command Executes
PXM
Syntax
xcnfred -pri <redPrimarySlotNum> -en <rowStatus> -sec <redSecondarySlotNum> -type <redType>
Syntax Description
Related Commands
dspred, delred
Attributes
Log: No State: Active Privilege: AnyExample 1-404 Add 1:1 redundancy between the card in slot 4 and the card in slot 1
node501.1.7.PXM.a > xcnfred -pri 1 -en 1 -ser 4 -type 1node501.1.7.PXM.a >xcnfrscprtn
Use the xcnfrscprtn command to partition PXM resources (bandwidth) as broadband interfaces.
Full Name
Configure Resource Partition Extended Parameters
Card(s) on Which This Command Executes
PXM
Syntax
xcnfrscprtn -pn <bbIfNum> -cn <ctrlrNum> -pr <rowStatus> -ps <inUse> -pi <ingrPctBw> -pe <egrPctBw> -pv <minVpi> -pu <maxVpi> -pc <minVci> -pd <maxVci> -pch <maxGLCNs>
Syntax Description
Attributes
Log: Yes State: Any Privilege: CiscoExample 1-405 Configure and enable a resource partition
spirit4.1.7.PXM.a > xcnfrscprtn -pn 1 -cn 1 -pr 1 -ps 1 -pi 100 -pe 100 -pi 0 -pu 4095 -pc 0 -pd 65535 - pth 32767spirit4.1.7.PXM.a >xcnfsrmlink
Use the xcnfsrmlink command to configure and to enable a link between a T1 line within a T3 line on an SRM-3T3 card and a slot and line number on a T1 service module.
Full Name
Configure Link
Card(s) on Which This Command Executes
PXM
Syntax
xcnfsrmlink -srmt3 <T3 line number> -srmt1 <T1 line number> -en <rowStatus> -srms1 <Target Slot number> -srmln <Slot line number>
Syntax Description
Related Commands
addlink, dsplink, dellink, xdspsrmlink
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-406 Configure and enable a link between the T1 line 1 within T3 line 2 on the SRM-3T3 card in slot 15 and T1 line number 5 on the T1 service module in slot 3
spirit4.1.7.PXM.a > xcnfsrmlink -srmt3 15.2 -srmt1 1 -en 1 -srmsl 3 -srmln 5 spirit4.1.7.PXM.a >xcnftrapmgr
Use the xcnftrapmgr command to configure, enable, and to disable the trap manager function on the PXM. If you enable the trap manager, this command allows you configure the number and IP address of the trap manager you intend to receive traps.
Full Name
Configure Trap Manager
Card(s) on Which This Command Executes
PXM
Syntax
xcnftrapmgr -ip <ip_addr> -pt <portnum> -en <enabled> -tf <TrapFlag> -seq <SeqNum>
Syntax Description
Related Commands
None
Attributes
Log: Yes State: Active Privilege: SuperUserExample 1-407
spirit4.1.8.PXM.a > xcnftrapmgr -ip 192.169.3.102 -pt 3 -tf 1 -seq 100 -en 1
spirit4.1.8.PXM.a >
xdelcon
Use the xdelcon command to remove a connection on an AUSM. A system response does not occur unless an error is detected.
Full Name
Delete a Connection
Card(s) on Which This Command Executes
AUSM
Syntax
xdelcon <connection number>
Syntax Description
Related Commands
delcon, xdspcon, dspcon, xdspcons, dspcons, xaddcon, addcon
Attributes
Log: Yes State: Active Privilege: 1-2xdnport
Use the xdnport command to deactivate a port. A system response does not occur unless an error is detected.
Full Name
Down Port
Card(s) on Which This Command Executes
AUSM
Syntax
xdnport -pt <PortNum> -e <PortEnable> -ptyp <PortType> -ln <LineNum>
Syntax Description
Related Commands
xupport
Attributes
Log: No State: Active Privilege: 1
xdspchan
Use the xdspchan command to view a channel on the current service card.
Full Name
Display Channel
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
xdspchan -chn <ChanNum>
Syntax Description
Related Commands
xdspchans, dspchans, xcnfchan, cnfchan
Attributes
Log: No State: Any Privilege: 1-6Examples
This section contains the following examples.
•
•
Example 1-408 Display the channel characteristics of channel 22 on the FRSM card in slot 20
spirit3.1.20.FRSM.a > xdspchan 22ChanNum: 22ChanRowStatus: AddChanPortNum: 1ChanDLCI: 1000EgressQSelect: 2IngressQDepth: 65535IngressQDEThresh: 32767IngressQECNThresh: 6553EgressQDepth: 65535EgressQDEThresh: 32767EgressQECNThresh: 6553DETaggingEnable: DisabledCIR: 9600Bc: 5100Be: 5100IBS: 100ForeSightEnable: DisabledQIR: 25MIR: 25PIR: 25ChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanType: SIW-XlatChanFECNmap: setEFCIzeroChanDEtoCLPmap: mapCLPChanCLPtoDEmap: mapDEChanFrConnType: PVCChanIngrPercentUtil: 100ChanEgrPercentUtil: 100ChanEgrSrvRate: 9600ChanOvrSubOvrRide: EnabledChanLocalVpi: 0ChanLocalVci: 1000ChanLocalNSAP: 504f504559453300000000000000000014000100ChanRemoteVpi: 0ChanRemoteVci: 0ChanRemoteNSAP: NULL NSAPChanMastership: SlaveChanVpcFlag: VccChanConnServiceType: ATFRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 25ChanConnMCR: 25ChanConnPercentUti: 100ChanNum: 42ChanRowStatus: ModChanPortNum: 20ChanDLCI: 300EgressQSelect: 2Type <CR> to continue, Q<CR> to stop:IngressQDepth: 65535IngressQDEThresh: 32767IngressQECNThresh: 6553EgressQDepth: 65535EgressQDEThresh: 32767EgressQECNThresh: 6553DETaggingEnable: DisabledCIR: 9600Bc: 5100Be: 5100IBS: 100ForeSightEnable: DisabledQIR: 25MIR: 25PIR: 25ChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanType: NIWChanFECNmap: setEFCIzeroChanDEtoCLPmap: mapCLPChanCLPtoDEmap: mapDEChanFrConnType: PVCChanIngrPercentUtil: 100ChanEgrPercentUtil: 100ChanEgrSrvRate: 9600ChanOvrSubOvrRide: EnabledChanLocalVpi: 0ChanLocalVci: 300ChanLocalNSAP: 504f504559453300000000000000000014001400ChanRemoteVpi: 17ChanRemoteVci: 18ChanRemoteNSAP: 504f504559453300000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: ATFRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 25ChanConnMCR: 25ChanConnPercentUti: 100ChanNumNextAvailable: 25spirit3.1.20.FRSM.a >Example 1-409 Display the channel characteristics of channel 33 on the CESM card in slot 22
spirit3.1.21.CESM.a > xdspchan 33ChanNum: 33ChanRowStatus: AddChanLineNum: 1ChanMapVpi: 5ChanMapVci: 33ChanCBRService: structuredChanClockMode: SynchronousChanCAS: BasicChanPartialFill: 47ChanMaxBufSize: 124 bytesChanCDVT: 1000 micro secondsC L I P: 2500 millisecondsChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: NotInProgressChanRTDresult: 65535 msChanPortNum 2ChanConnType PVCISDetType DetectionDisabledCondData 255CondSignalling 0ExtISTrig DisableIdleSupressionISIntgnPeriod 4095 secondsISSignallingCode 0OnHookCode 1ChanLocalVpi: 0ChanLocalVci: 0ChanLocalNSAP: 504f504559453300000000000000000015000200ChanRemoteVpi: 0ChanRemoteVci: 0ChanRemoteNSAP: NULL NSAPChanMastership: SlaveChanVpcFlag: VccChanConnServiceType: CBRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 688ChanConnMCR: 688ChanConnPercentUtil: 100ChanNum: 41ChanRowStatus: ModChanLineNum: 3ChanMapVpi: 5ChanMapVci: 41ChanCBRService: unstructuredChanClockMode: SynchronousChanCAS: BasicChanPartialFill: 47ChanMaxBufSize: 7680 bytesChanCDVT: 20000 micro secondsC L I P: 30000 millisecondsChanLocalRemoteLpbkState: DisabledChanTestType: TestOffChanTestState: FailedChanRTDresult: 65535 msChanPortNum 10ChanConnType PVCISDetType DetectionDisabledCondData 255CondSignalling 8Type <CR> to continue, Q<CR> to stop:ExtISTrig DisableIdleSupressionISIntgnPeriod 4095 secondsISSignallingCode 0OnHookCode 1ChanLocalVpi: 0ChanLocalVci: 0ChanLocalNSAP: 504f504559453300000000000000000015000a00ChanRemoteVpi: 11ChanRemoteVci: 111ChanRemoteNSAP: 504f504559453300000000000000000000000100ChanMastership: MasterChanVpcFlag: VccChanConnServiceType: CBRChanRoutingPriority: 1ChanMaxCost: 255ChanRestrictTrunkType: No RestrictionChanConnPCR: 4107ChanConnMCR: 4107ChanConnPercentUtil: 100ChanNumNextAvailable: 49spirit3.1.21.CESM.a >xdspchancnt
Use the xdspchancnt command to view the counter contents of all channels (or the specified channel with the optional -chn parameter).
Full Name
Display Channel Count
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
xdspchancnt -chn <ChanNum>
Syntax Description
Related Commands
dspchancnt, xdspchstats, dspchstats
Attributes
Log: No State: Any Privilege: 1-6
Examples
This section contains the following examples:
•
•
•
•
•
Example 1-410 Display the channel counters of all the channels on the FRSM card in slot 20
spirit3.1.20.FRSM.a > xdspchancnt -chn 22ChanNum: 22ChanState: okayChanUpTime: 1634994Tx Rx--------------- ---------------AbitState: Sending A=1 OffATMState: Not sending any state Not receiving any stateTotal Frames: 64187 57994Total Bytes: 3410008 3317254Frames DE: 0 0Bytes DE: 0 0Frames Discarded: 2 7079Bytes Discarded: 118 410582FramesDiscXceedQDepth: 0 0BytesDiscXceedQDepth: 0 0FramesDiscXceedDEThresh: 0 0Frames FECN: 0 0Frames BECN: 0 0FramesTagged FECN: 0 0FramesTagged BECN: 0 0KbpsAIR: 0 0Type <CR> to continue, Q<CR> to stop:Tx Rx--------------- ---------------FramesTaggedDE: 0 0BytesTaggedDE: 0 0RcvFramesDiscShelfAlarm: 0XmtFramesDiscPhyLayerFail: 0XmtFramesDiscCRCError: 0XmtFramesDiscReAssmFail: 0XmtFramesDiscSrcAbort: 0XmtFramesDuringLMIAlarm: 14XmtBytesDuringLMIAlarm: 794RcvFramesDiscUPC: 0XmtFramesInvalidCPIs: 0XmtFramesLengthViolations: 0XmtFramesOversizedSDUs: 0XmtFramesUnknownProtocols: 0RcvFramesUnknownProtocols: 7079Type <CR> to continue, Q<CR> to stop:ChanNum: 42ChanState: alarmChanUpTime: 4Tx Rx--------------- ---------------AbitState: Sending A=0 OffATMState: Sending AIS OAM state Receiving AIS OAMTotal Frames: 0 0Total Bytes: 0 0Frames DE: 0 0Bytes DE: 0 0Frames Discarded: 0 0Bytes Discarded: 0 0FramesDiscXceedQDepth: 0 0BytesDiscXceedQDepth: 0 0FramesDiscXceedDEThresh: 0 0Frames FECN: 0 0Frames BECN: 0 0FramesTagged FECN: 0 0FramesTagged BECN: 0 0KbpsAIR: 0 0Type <CR> to continue, Q<CR> to stop:Tx Rx--------------- ---------------FramesTaggedDE: 0 0BytesTaggedDE: 0 0RcvFramesDiscShelfAlarm: 0XmtFramesDiscPhyLayerFail: 0XmtFramesDiscCRCError: 0XmtFramesDiscReAssmFail: 0XmtFramesDiscSrcAbort: 0XmtFramesDuringLMIAlarm: 0XmtBytesDuringLMIAlarm: 0RcvFramesDiscUPC: 0XmtFramesInvalidCPIs: 0XmtFramesLengthViolations: 0XmtFramesOversizedSDUs: 0XmtFramesUnknownProtocols: 0RcvFramesUnknownProtocols: 0Example 1-411 Display the channel counters of channel 17 on the PXM card in slot 7
spirit4.1.7.PXM.a > xdspchancnt -cnt 17Channel Number : 17Channel State : alarmChannel Ingress State : alarmChannel Egress State : otherCLP=0 Rcvd. Cells : 0CLP=1 Rcvd. Cells : 0GCRA1 Non Conforming Cells : 0GCRA2 Non Conforming Cells : 0EOF Cells Rcvd. : 0CLP=0 Discard Cells : 0CLP=1 Discard Cells : 0Total Xmtd. Cells : 2125CLP=0 Xmtd. Cells : 0CLP=1 Xmtd. Cells : 3203CLP=0 Discard Cells to Port : 0CLP=1 Discard Cells to Port : 0spirit4.1.7.PXM.a >Example 1-412 Display the channel counters of all the channels on the CESM card in slot 21
spirit3.1.21.CESM.a > xdspchancntChanNum: 33Chan State: alarmChan RCV ATM State: NormalChan XMT ATM State: Sending AIS OAMCell Loss Status: No Cell LossReassembled Cells: 0Generated Cells: 1234508943Header Errors: 0Seqence Mismatches : 0Lost Cells: 0Channel Uptime (secs.) 1808376Signalling Status OffhookType <CR> to continue, Q<CR> to stop:ChanNum: 41Chan State: alarmChan RCV ATM State: NormalChan XMT ATM State: Sending AIS OAMCell Loss Status: Cell LossReassembled Cells: 0Generated Cells: 317857344Header Errors: 0Seqence Mismatches : 0Lost Cells: 0Channel Uptime (secs.) 77406Signalling Status Offhookspirit3.1.21.CESM.a >Example 1-413 Display the channel counters of channel 33 on the CESM card in slot 21
spirit3.1.21.CESM.a > xdspchancnt -chn 33ChanNum: 33Chan State: alarmChan RCV ATM State: NormalChan XMT ATM State: Sending AIS OAMCell Loss Status: No Cell LossReassembled Cells: 0Generated Cells: 1234551200Header Errors: 0Seqence Mismatches : 0Lost Cells: 0Channel Uptime (secs.) 1808438Signalling Status Offhookspirit3.1.21.CESM.a >Example 1-414 Display the channel counters of channel 22 on the FRSM card in slot 20
spirit3.1.20.FRSM.a > xdspchancnt -chn 22ChanNum: 22ChanState: okayChanUpTime: 1635192Tx Rx--------------- ---------------AbitState: Sending A=1 OffATMState: Not sending any state Not receiving any stateTotal Frames: 64187 58001Total Bytes: 3410008 3317660Frames DE: 0 0Bytes DE: 0 0Frames Discarded: 2 7079Bytes Discarded: 118 410582FramesDiscXceedQDepth: 0 0BytesDiscXceedQDepth: 0 0FramesDiscXceedDEThresh: 0 0Frames FECN: 0 0Frames BECN: 0 0FramesTagged FECN: 0 0FramesTagged BECN: 0 0KbpsAIR: 0 0Type <CR> to continue, Q<CR> to stop:Tx Rx--------------- ---------------FramesTaggedDE: 0 0BytesTaggedDE: 0 0RcvFramesDiscShelfAlarm: 0XmtFramesDiscPhyLayerFail: 0XmtFramesDiscCRCError: 0XmtFramesDiscReAssmFail: 0XmtFramesDiscSrcAbort: 0XmtFramesDuringLMIAlarm: 14XmtBytesDuringLMIAlarm: 794RcvFramesDiscUPC: 0XmtFramesInvalidCPIs: 0XmtFramesLengthViolations: 0XmtFramesOversizedSDUs: 0XmtFramesUnknownProtocols: 0RcvFramesUnknownProtocols: 7079spirit3.1.20.FRSM.a >xdspchans
Use the xdspchans command to view the current channels on the card.
Full Name
Display Channels
Card(s) on Which This Command Executes
PXM, FRSM, CESM
Syntax
xdspchans
Related Commands
xdspchan, dspchan, addchan, delchan
Attributes
Log: No State: Any Privilege: 1-6Examples
This section contains the following examples.
•
•
•
Example 1-415 Display the channels on the current PXM
spirit4.1.7.PXM.a > xdspchansChan Stat Intf locVpi locVci conTyp srvTyp PCR[0+1] Mst rmtVpi rmtVci State----------------------------------------------------------------------------17 ADD 2 39 45 VCC VBR 353208 Slv 0 0 alarmspirit4.1.7.PXM.a >Example 1-416 Display the channels on the current FRSM
spirit3.1.20.FRSM.a > xdspchansDLCI Chan EQ I/EQDepth I/EQDEThre I/EECNThre Fst/ DE Type Alarm------------- ---- -- ----- ----- ----- ----- ----- ----- --- --- ----- -----20.1.1.1000 22 2 65535/65535 32767/32767 6553/6553 Dis/Dis SIW-X No20.8.20.300 42 2 65535/65535 32767/32767 6553/6553 Dis/Dis NIW YesNumber of channels: 2ChanNumNextAvailable: 26spirit3.1.20.FRSM.a >Example 1-417 Display the channels on the current CESM
spirit3.1.21.CESM.a > xdspchansChannel ChanNum Status CDVT MaxBufSize CLIP CBRservice------------ ------- ------ ----- ---------- ------ ------------21.1.2.33 33 Add 1000 124 2500 structured21.3.10.41 41 Mod 20000 7680 30000 unstructuredNumber of channels: 2ChanNumNextAvailable: 47spirit3.1.21.CESM.a >xdspcon
Use the xdspcon command to view AUSM configuration data.
Full Name
Display Connection
Card(s) on Which This Command Executes
AUSM
Syntax
xdspcon -chn <channel number>
Syntax Description
-chn
Command delineator that precedes the channel number entry.
channel number
Channel number, in the range 16-1015.
Related Commands
dspcon, xaddcon, addcon, xdelcon, delcon, xdspcons, dspcons
Attributes
Log: No State: Any Privilege: 1-6Example 1-418 Display the connection parameters for channel 16
spirit3.1.22.AUSM8.a > xdspcon -chn 16ChanNum: 16RowStatus: DelConnectionType: VCCServiceType: CBRPortNum: 1VPI: 0VCI (For VCC): 0Local VPId(for VPC): 0EgressQNum: 0IngressQDepth(cells): 1000IngressDiscardOption: CLP hysterisisIngressFrameDiscardThreshold 1000IngressQCLPHigh(cells): 900IngressQCLPLow(cells): 800QCLPState: LOWIngressEfciThreshold(cells): 1000UPCEnable: EnabledPeakCellRate[0+1](cells/sec): 50CellDelayVariation[0+1]: 10000 (micro secs)PeakCellRate[0](cells/sec): 50CellDelayVariation[0]: 10000 (micro secs)SustainedCellRate(cells/sec): 50Type <CR> to continue, Q<CR> to stop:MaximumBurstSize(cells): 1000SCRPolicing: CLP[0]CLPTagEnable: EnabledFrameGCRAEnable: DisableForesightEnable: DisableInitialBurstSize(cells): 0ForeSightPeakCellRate(cells/sec): 50MinimumCellRate(cells/sec): 0InitialCellRate(cells/sec): 1LocalRemoteLpbkState: DisableChanTestType: No TestChanTestState: Not In ProgressChanRTDresult: 65535 msIngress percentage util: 100Egress percentage util : 100Egress Service Rate: 50LocalVpi: 0LocalVci: 0spirit3.1.22.AUSM8.a >Type <CR> to continue, Q<CR> to stop:LocalNSAP: 5468697320697320612064756d6d79204e534150RemoteVpi: 0RemoteVci: 0RemoteNSAP: 5468697320697320612064756d6d79204e534150Mastership: SlaveVpcFlag: VccConnServiceType: CBRRoutingPriority: 1MaxCost: 255RestrictTrunkType: No RestrictionConnPCR: 50ConnMCR: 0ConnPercentUtil: 100ChanNumNextAvailable : 16Local VpId NextAvailable : 4spirit3.1.22.AUSM8.a >xdspcons
Use the xdspcons command to view details of all connections between the current AUSM and the card to which the current shelf is attached.
Full Name
Display Connections
Card(s) on Which This Command Executes
AUSM
Syntax
xdspcons
Related Commands
dspcons, xaddcon, addcon, xdelcon, delcon, xdspcon
Attributes
Log: No State: Any Privilege: 1-6Example 1-419 Display parameters for the connections on the current AUSM
spirit.1.19.AUSM8.a > xdspconsChan Port.VPI.VCI ConnType Service Type PCRlot1 Q-Depth State30 1.10.100 VCC ABR 3622 2000 Active33 1.10.200 VPC CBR 3622 100 Alarmspirit.1.19.AUSM8.a >xdspdsx3bert
Use the xdspdsx3bert command to view parameters and results of the current BERT testing session.
Full Name
Display DSX3 BERT
Card(s) on Which This Command Executes
FRSM 2T3E3, CESMT3
Syntax
xdspdsx3bert
Attributes
Log: No State: Active Privilege: Any
Example 1-420 Display the results of the current BERT testing session
popeye1.1.21.CESMT3.a > xdspdsx3bertBert Control: Start dsx3BertBert Resource Status State: In UseBert Owner: CLIBert Status: In SyncBert Test Medium: LineBert Port: 1Line Number : 1Bert Mode : bertPatternTestBert Pattern : doubleOneZeroLoopback type: metallicLoopbackStart time (secs.) 14:14:44Start Date FRI JUL 02 1999Bit countupper: 0Bit countlower: 1553476045Bit Error Countupper 0Bit Error Countlower 0Error Insertion Rate: Error injection disabledError Insertion count: 0DSX3 BERT in Syncpopeye1.1.21.CESMT3.a >xdspilmi
Use the xdspilmi command to view the interim local management interface (ILMI) configuration.
Full Name
Display ILMI
Card(s) on Which This Command Executes
PXM, AUSM
Syntax: PXM
xdspilmi -ifNum <sigPortNum>
Syntax Description
-ifNum
Command delineator that precedes the sigPortNum entry.
sigPortNum
Number of the broadband interface port.
Syntax: AUSM
xdspilmi -pt <PortNum>
Syntax Description
-pt
Command delineator that precedes the PortNum entry.
PortNum
Number of the broadband interface port.
Related Commands
cnfilmi, xcnfilmi, dspilmicnt
Attributes
Log: No State: Any Privilege: 1-6Examples
This section contains the following examples.
•
•
Example 1-421 Display the ILMI configuration for port 1 on the PXM
porky.1.7.PXM.a > xdspilmi -ifNum 1Sig. Ilmi Sig Sig Ilmi T491 T492 T493 AddrPort State/Type Vpi Vci Trap/Int KA ErrTh/Pollint EvntTh EnqInt Reg.---- --------- ---- ---- -------- --- ------------- ------ ------ ----1 Off/none 0 16 Off/01 Off 3/v6 4 10 Offporky.1.7.PXM.a >Example 1-422 Display the ILMI configuration for port 1 on the AUSM
porky.1.19.AUSM8.a > xdspilmi -pt 1Port Num: 1Signalling: No signallingSignallingVPI: 0SignallingVCI: 0ILMITrap: DisabledILMI-Min-Trap-Interval (secs): 1KeepAlivePolling: DisabledErrorThreshold: 3EventThreshold: 4PollingInterval (secs): 30MinimumEnquiryInterval (secs) 10EXT Operation: port 2porky.1.19.AUSM8.a >xdspln
Use the xdspln command to view configuration for a specified line.
Full Name
Display Line Configuration
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
xdspln -ds1 <line number>
or
xdspln -rs232 <line number>
Syntax Description
Related Commands
addln, xcnfln, cnfln, delln
Attributes
Log: No State: Any Privilege: 1-6Examples
This section contains the following examples.
•
•
•
•
Example 1-423 Display line 2 on the current AUSM card
spirit3.1.22.AUSM8.a > xdspln -ds1 2spirit3.1.22.AUSM8.a >Example 1-424 Display line 8 on the current CESM card
spirit.1.17.CESM.a > xdspln -ds1 8LineNum: 8LineConnectorType: SMBLineEnable: EnabledLineType: dsx1E1CASLineCoding: dsx1HDB3LineLength: G.703 75 ohmLineXmtClockSource: LocalTimingLineLoopbackCommand: NoLoopLineSendCode: NoCodeLineUsedTimeslotsBitMap: 0x0LineLoopbackCodeDetection: codeDetectDisabledLineNumOfValidEntries: 8spirit.1.17.CESM.a >Example 1-425 Display line 1 on the current FRSM card
spirit.1.1.FRSM.a > xdspln -ds1 1LineNum: 1LineConnectorType: RJ-48LineType: dsx1ESFLineEnable: DisableLineCoding: dsx1B8ZSLineLength: 0-131 ftLineXmtClockSource: LocalTimingLineLoopbackCommand: NoLoopLineSendCode: NoCodeLineUsedTimeslotsBitMap: 0x0LineLoopbackCodeDetection: codeDetectDisabledLineBertEnable: DisableLineNumOfValidEntries: 8spirit.1.1.FRSM.a >Example 1-426 Display the RS232 line 1 on the current CESM card
spirit3.1.21.CESM.a > xdspln -rs232 1Port Type Enable Baudrate---- ---------------------- -------- --------21.1 Maintenance RS232 Port Disable 19200SerialPortNumOfValidEntries: 1spirit3.1.21.CESM.a >xdsplns
Use the xdsplns command to view the configuration parameters for all lines on the current card.
Full Name
Display Lines
Card(s) on Which This Command Executes
PXM FRSM, AUSM, CESM
Syntax
xdsplns
Related Commands
dsplns, addln, xaddln, cnfln, xcnfln, xdelln, delln
Attributes
Log: No State: Any Privilege: 1-6Examples
This section contains the following examples.
•
•
•
•
•
Example 1-427 Display DS1 lines on the current FRSM card
spirit.1.1.FRSM.a > xdsplns -ds1Line Conn Type Status/Coding Length XmtClock Alarm StatsType Source Alarm---- ----- ------------ ------ -------- ------------- -------- ----- -----1.1 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.2 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.3 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.4 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.5 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.6 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.7 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTim1.8 RJ-48 dsx1ESF Dis/dsx1B8ZS 0-131 ft LocalTimLineNumOfValidEntries: 8spirit.1.1.FRSM.a >Example 1-428 Display RS-232 lines on the current FRSM card
spirit.1.1.FRSM.a > xdsplns -rs232Port Type Enable Baudrate---- ---------------------- -------- --------1.1 Maintenance RS232 Port Disable 19200SerialPortNumOfValidEntries: 1spirit.1.1.FRSM.a >Example 1-429 Display lines on the current PXM with a T3 trunk back card
spirit.1.7.PXM.a > xdsplnsLine Type Coding Length Criteria AIScBitsCheck---- -------------- -------- ------------- ----------- -------------2.1 dsx3CbitParity dsx3B3ZS LessThan450ft 3 out of 8 Check C-bitsLineNumOfValidEntries: 1spirit.1.7.PXM.a >Example 1-430 Display lines on the current PXM with a SONET 155 back card
spirit.1.7.PXM.a > xdsplnsMedium Medium Medium MediumSonet Line Line HSC Payload Frame Time Valid Line LineLine Type Lpbk mask Scramble Scramble Elapsed Intvls Coding Type---- -------------- -------- ------------- ----------- ------------------LineNumOfValidEntries: 1spirit.1.7.PXM.a >Example 1-431 Display E1 lines on the current CESM
spirit.1.17.CESM.a > xdsplns -ds1Line Conn Type Status/Coding Length XmtClock Alarm StatsType Source Alarm---- ----- ------------ ------ -------- ------------- -------- ----- -----17.1 SMB dsx1E1CAS Ena/dsx1HDB3 G.703 75 ohm LocalTim Yes No17.2 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.3 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.4 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.5 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.6 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.7 SMB dsx1E1CAS Dis/dsx1HDB3 G.703 75 ohm LocalTim17.8 SMB dsx1E1CAS Ena/dsx1HDB3 G.703 75 ohm LocalTim Yes NoLineNumOfValidEntries: 8spirit.1.17.CESM.a >xdspport
Use the xdspport command on the PXM to view the port configuration for the specified PXM port.
Use the xdspport command on an FRSM and CESM to view the port configuration for the specified port.
Use the xdspport command on an AUSM to view the Physical Layer Protocol Processor of a port on the current AUSM.
Full Name
Display Port
Card(s) on Which This Command Executes
PXM, FRSM, AUSM, CESM
Syntax
xdspport <port number>
or
xdspport -port <port number>
(for PXM)Syntax Description
Related Commands
FRSM and CESM: addport, xcnfport, cnfport, delport
AUSM: xupport, upport, xdnport, dnport
Attributes
Log: No State: Active Privilege: 1-6Examples
This section contains the following examples.
•
•
•
Example 1-432 Display the port configuration for port 2 on the PXM
raviraj.1.7.PXM.a > xdspport -port 1Port Status Line PctBw minVpi maxVpi------------------------------------------------------1 OFF 0 0 0 0raviraj.1.7.PXM.a >Example 1-433 Display the port configuration for port 1 on the current FRSM
spirit.1.17.FRSM.a > xdspport 1SlotNum: 17PortLineNum: 1PortNum: 1PortRowStatus: AddPortDs0Speed: 64kPortDs0ConfigBitMap: 0xffffffPortEqueueServiceRatio: 1PortFlagsBetweenFrames: 1PortSpeed: 1536kbpsSignallingProtocolType: NoSignallingAsynchronousUpdates: DisableT391LineIntegrityTimer: 10T392PollingVerificationTimer: 15N391FullStatusPollingCounter: 6N392ErrorThreshold: 3N393MonitoredEventCount: 4PortState: FailedDuetoLineFailurePortSignallingState: No Signalling FailureCLLMEnableStatus: DisableCLLMxmtStatusTimer: 0PortDs0UsedLine1: 0x00ffffffPortDs0UsedLine2: 0x00ffffffPortDs0UsedLine3: 0x00ffffffPortDs0UsedLine4: 0x00ffffffPortNumNextAvailable: 60Syntax : dspport "port_num"port number—values ranging from 1-192 are acceptedspirit.1.17.FRSM.a >Example 1-434 Display port 1 on the current AUSM
spirit.1.20.AUSM.a > xdspport 1PortNumber: 1Cell Framing: ATMCell Scramble: No ScramblePlpp Loopback: No Loopbackspirit.1.20.AUSM.a >xdspportcnt
Use the xdspportcnt command to view counters for a specified port on an FRSM or AUSM.
Full Name
Display Port Counters
Card(s) on Which This Command Executes
FRSM, AUSM
Syntax
xdspportcnt <port number>
Syntax Description
port number
Port number, using the range appropriate for the current card.
•
•
•
Related Commands
cnfcd, dspcds
Attributes
Log: No State: Any Privilege: 1-6
Examples
This section contains the following examples:
•
•
Example 1-435 Display port counters on port 1 of the current AUSM
spirit.1.20.AUSM.a > dspportcnt 1PortNum: 1PortState: Sig. FailureIngressRcvCells: 0IngressRcvCellRate (cells/sec): 0IngressRcvUtilization (percentage): 0IngressXmtCells: 0IngressGFCErrorCells: 0IngressVpiVciErrCells: 0IngressUnknownVpiVci: 0x0IngressRcvClpSetCells: 0EgressRcvCells: 0EgressRcvCellRate (cells/sec): 0EgressRcvUtilization (percentage): 0EgressXmtCells: 0EgressXmtCellRate (cells/sec): 0EgressXmtUtilization (percentage): 0EgressPortAlarmDiscardCells: 0EgressXmtClpSetCells: 0EgressXmtEfciSetCells: 0PortXmtAisCells: 0PortXmtSgmtLpbkCells: 0PortRcvAisCells: 0PortRcvFerfCells: 0PortRcvSgmtLpbkCells: 0PortRcvCrcErrOAMCells: 0TotalIngressQFullDiscardCells: 0TotalIngressClpSetDiscardCells: 0TransmitFIFOFullCount (per card): 0ReceivedHECErrorCells: 0HECErroredSeconds: 0SeverelyHECErroredSeconds: 0spirit.1.20.AUSM.a >Example 1-436 Display port counters on port 1 of the current FRSM
spirit.1.17.FRSM.a > dspportcnt 1PortNum: 1Tx Rx--------------- ---------------Total Frames: 233706 228459Total Bytes: 6181533 5892272Frames FECN: 0 0Frames BECN: 0 0Frames Abort: 0 2Buf Not Available: 0 0KbpsAIR: 0 0XmtFramesDiscXceedQDepth: 0XmtBytesDiscXceedQDepth: 0XmtFramesDuringLMIAlarm: 17XmtByteDuringLMIAlarm: 791XmtFramesUnderrun: 0RcvFramesDE: 0RcvFramesDiscCRCError: 0RcvFramesDiscIllegalHeader: 0RcvFramesDiscAlignmentError: 0RcvFramesDiscIllegalLen: 0RcvFramesDiscXceedDEThresh: 0RcvFramesDiscNoChan: 0RcvFramesUnknownDLCI: 2RcvLastUnknownDLCI: 0RcvFramesTaggedFECN: 0RcvFramesTaggedBECN: 0RcvFramesTaggedDE: 0Status: 169459 0StatusInquiry: 0 169459AsynchUpdate: 0 0RcvInvalidRequest: 0RcvUNISeqMismatch: 1RcvNNISeqMismatch: 0UNISignallingTimeout: 3NNISignallingTimeout: 0FramesCLLM: 0 0BytesCLLM: 0 0CLLMFailures: 0Type <CR> to continue, Q<CR> to stop:PortNum: 20Tx Rx--------------- ---------------Total Frames: 0 0Total Bytes: 0 0Frames FECN: 0 0Frames BECN: 0 0Frames Abort: 0 0Buf Not Available: 0 0KbpsAIR: 0 0XmtFramesDiscXceedQDepth: 0XmtBytesDiscXceedQDepth: 0XmtFramesDuringLMIAlarm: 0XmtByteDuringLMIAlarm: 0XmtFramesUnderrun: 1RcvFramesDE: 0RcvFramesDiscCRCError: 0RcvFramesDiscIllegalHeader: 0RcvFramesDiscAlignmentError: 0RcvFramesDiscIllegalLen: 0RcvFramesDiscXceedDEThresh: 0RcvFramesDiscNoChan: 0RcvFramesUnknownDLCI: 0RcvLastUnknownDLCI: 0RcvFramesTaggedFECN: 0RcvFramesTaggedBECN: 0RcvFramesTaggedDE: 0Status: 0 0StatusInquiry: 0 0AsynchUpdate: 0 0RcvInvalidRequest: 0RcvUNISeqMismatch: 0RcvNNISeqMismatch: 0UNISignallingTimeout: 0NNISignallingTimeout: 0FramesCLLM: 0 0BytesCLLM: 0 0CLLMFailures: 0spirit3.1.20.FRSM.a >xdspportq
Use the xdspportq command to view queue information for a specified port and egress queue on the AUSM.
Full Name
Display a Specified Egress Queue on the Specified Port
Card(s) on Which This Command Executes
AUSM
Syntax
xdspportq -pt <port number> -pqn <egress queue number>
Syntax Description
Related Commands
dspportq, dspportqs
Attributes
Log: No State: Any Privilege: 1-6Example 1-437 Display queue information for egress queue 1 on port 1
spirit3.1.22.AUSM8.a > xdspportq -pt 1 -pqn 1ServicePortNum: 1QueueNumber: 1PortBinState: DisableServiceSequence: 255QueueDepth(cells): 500CLPThresholdHigh(cells): 450CLPThresholdLow(cells): 400EFCIThreshold(cells): 400QueueAlgorithm: 255MaxBandwidthIncrement: 4096MinBandwidthIncrement: 0QCLPState: LowQFullDiscardedCells: 0CLPSetDiscardedCells: 0spirit3.1.22.AUSM8.a >xdspportqs
Use the xdspportqs command to view queue information for all the egress queues on an AUSM port.
Full Name
Display All Egress Queues on a Specified Port
Card(s) on Which This Command Executes
AUSM
Syntax
xdspportqs <port number>
Syntax Description
Related Commands
dspportqs, xdspportq, dspportq
Attributes
Log: No State: Any Privilege: 1-6Example 1-438 Display egress queue information for all the egress queues on port 1
spirit.1.20.AUSM.a > xdspportqs 1Port Q Num State Q-Algo Service-Seq Depth-Max CLP-High CLP-Low EFCI-Thrsh---- ----- ----- ------ ----------- --------- -------- ------- ----------1 1 Enabled 3 1 200 180 160 1601 2 Enabled 3 2 900 800 700 7001 3 Enabled 3 3 900 800 700 7004 1 Enabled 3 1 200 180 160 1604 2 Enabled 3 2 900 800 700 7004 3 Enabled 3 3 900 800 700 700spirit.1.20.AUSM.a >xdspports
Use the xdspports command to view information on all the ports associated with the current card.
Full Name
Display Ports
Card(s) on Which This Command Executes
FRSM, AUSM, CESM
Syntax
xdspports
Related Commands
dspport, addport, cnfport, delport, dspport
Attributes
Log: No State: Any Privilege: 1-6Example 1-439 Display the ports on the current FRSM
raviraj.1.3.FRSM.a > xdspportsPort Ena/Speed EQServ SignalType T391 T392 N391 N392 N393 Type Alarm ELMIRatio-------- --- ----- ------ ------------ ---- ---- ---- ---- ---- -------- ----- ----3.1.1 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.2 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.3 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.4 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.5 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.6 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.7 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No Off3.1.8 Add/ 192k 1 NoSignalling 10 15 6 3 4 frameRel No OffNumber of ports: 8PortDs0UsedLine1: 0x00ffffffPortDs0UsedLine2: 0x00000000PortDs0UsedLine3: 0x00000000PortDs0UsedLine4: 0x00000000PortDs0UsedLine5: 0x00000000PortDs0UsedLine6: 0x00000000PortDs0UsedLine7: 0x00000000PortDs0UsedLine8: 0x00000000PortNumNextAvailable: 89raviraj.1.3.FRSM.a >xdspred
Use the xdspred command to view the currently configured redundant slot links on the switch.
Full Name
Display Redundancy
Card(s) on Which This Card Executes
PXM
Syntax
xdspred
Related Commands
addred, delred, dspred, xcnfred
Attributes
Log: No State: Active Privilege: SuperUser
Example 1-440 Show the status of redundant slot links
raviraj.1.7.PXM.a > xdspredPrimary Primary Primary Secondary Secondary Secondary Red. Red.SlotSlotNum Type State SlotNum Type State Type Cover------- ------- ------- --------- --------- --------- ---- --------4 FRSM-2CT Active 10 FRSM-2CT Standby 1:1 0raviraj.1.7.PXM.a >xdspshelf
Use the xdspshelf command to view shelf information on card and line status.
Full Name
Display Shelf
Card(s) on Which This Command Executes
PXM
Syntax
xdspshelf
Related Commands
dspshelf
Attributes
Log: No State: Any Privilege: Cisco_GPExample 1-441 Display characteristics of the shelf information on card and line status
spirit.1.8.PXM.a > xdspshelfNumOfValidEntries: 32NodeName: spiritDate: 01/29/1999Time: 18:12:48TimeZone: GMTTimeZoneGMTOff: 0StatsMasterIpAddress: 0.0.0.0shelfIntegratedAlarm: ClearBkplnSerialNum: 12345BkplnType: 2BkplnFabNumber:BkplnHwRev: 80spirit.1.8.PXM.a >xdspsrmlink
Use the xdspsrmlink command to view a link on a specific T3 line on an SRM-3T3 card.
Full Name
Display Link
Card(s) on Which This Command Executes
PXM
Syntax
xdspsrmlink -srmt3 <T3LineNum> -srmt1 <T1Slot> -srmsl <TargetSlotNum> <T3LineNum>
Syntax Description
Related Commands
dellink, addlink
Attributes
Log: No State: Any Privilege: AnyExample 1-442 Display characteristics of the SRM T3 link
spirit.1.8.PXM.a > xdspsrmlink 7.1
xdsptrapmgr
Use the xdsptrapmgr command to view trap information collected by the PXM trap manager. This information contains the IPAddress, port number, trap flag operational status, row status, and the current sequence number of the next trap.
Full Name
Display Trap Manager
Card(s) on Which This Command Executes
PXM
Syntax
xdsptrapmgr
Related Commands
cnftrapmgr
Attributes
Log: No State: Any Privilege: AnyExample 1-443
raviraj.1.7.PXM.a > xdsptrapmgripAddress PortNum RowStatus ReadTrapFlag NextTrapSeqNum--------------- ------- ---------- ------------ --------------172.29.28.41 2500 Add Off 260338LastTrapSeqNum: 260837NumOfValidEntries: 1raviraj.1.7.PXM.a >xdspusers
Use the xdspusers command to view the list of currently configured user identifications and associated access levels.
Full Name
Display User(s)
Card(s) on Which This Command Executes
PXM
Syntax
xdspusers
or
xdspusers -u <userId>Syntax Description
-u
Command delineator that precedes the userId entry.
userId
String of up to12 characters that identify a specific user.
Related Commands
dspusers
Attributes
Log: No State: Any Privilege: CISCO_GPExamples
This section contains the following examples.
•
•
Example 1-444 Show all currently configured users
raviraj.1.7.PXM.a > xdspusersUserId AccessLevel-------------------------cisco CISCO_GPservice SERVICE_GPsuperuser SUPER_GPraviraj.1.7.PXM.a >Example 1-445 Show access level for a specified user
raviraj.1.7.PXM.a > xdspuser -u superuserUserId AccessLevel-------------------------superuser SUPER_GPraviraj.1.7.PXM.a >xupport
Use the xupport command to bring up a port on the AUSM.
Full Name
Up Port
Card(s) on Which This Command Executes
AUSM
Syntax
xupport -pt <PortNum> -e <PortEnable> -ptyp <PortType> -ln <PhysLineNum>
Syntax Description
Related Commands
upport, xdnport, dnport
Attributes
Log: Yes State: Active Privilege: 1Example 1-446 Bring up port 1 on physical line 1 on the AUSM in slot 22 as an NNI port
spirit3.1.22.AUSM8.a > xupport -pt 1 -e 2 -ptyp 1 -ln 1spirit3.1.22.AUSM8.a >A system message does not occur unless an error is detected.
